PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.374400.1

Common Name

Csa_5G137430, LOC101222428

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

bZIP

Protein Properties

Length: 163aa MW: 18774.1 Da PI: 5.2887

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.374400.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	49.7	8.2e-16	54	112	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +++rr+++N e+ArrsR RK++ ++eL v L +eN++L ++l++l++ ++l +e+ Cucsa.374400.1 54 RKQRRMISNWESARRSRMRKQKHLDELWSVVLHLRTENHSLMEKLNQLTDSEQQLLQEN 112 79*****************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	5.5E-14	50	114	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.496	52	115	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.06E-11	54	105	No hit	No description
Pfam	PF00170	5.8E-14	54	112	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	5.0E-12	54	110	No hit	No description
CDD	cd14702	1.26E-16	55	102	No hit	No description
PROSITE pattern	PS00036	0	57	72	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MEISGAHFFA PEKYGMIQNP NINELLSCIP VNSISTSDDG DDQNHKPGIV IDERKQRRMI 60 SNWESARRSR MRKQKHLDEL WSVVLHLRTE NHSLMEKLNQ LTDSEQQLLQ ENVKLKEEAL 120 NLHRMITDIQ MGSPYTTHLR ELEEAPCNTF VIMAESSSQS DE*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	66	73	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269\|PubMed:26973252}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681895	0.0	LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBank	LN713263	0.0	LN713263.1 Cucumis melo genomic chromosome, chr_9.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011654565.1	1e-118	PREDICTED: basic leucine zipper 43
Swissprot	Q9FMC2	8e-30	BZP43_ARATH; Basic leucine zipper 43
TrEMBL	A0A0A0KJA6	1e-117	A0A0A0KJA6_CUCSA; Uncharacterized protein
STRING	XP_004149503.1	1e-117	(Cucumis sativus)
STRING	XP_004164850.1	1e-116	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF24530	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G30530.1	1e-36	basic leucine-zipper 42

Link Out ? help Back to Top
Phytozome	Cucsa.374400.1
Entrez Gene	101222428

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Nowak K,Gaj MD Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis. J. Plant Physiol., 2016. 193: p. 119-26 [PMID:26973252] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]