![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_000917 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 56aa MW: 6056.83 Da PI: 10.4718 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 50.5 | 8.3e-16 | 15 | 55 | 9 | 49 |
TCP 9 skihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktie 49
+ k+ gR+RR+R+sa+caar+F+L++ LG+ +d+ ti+
DCAR_000917 15 KEKNIKGQGRGRRIRVSAPCAARIFQLTEDLGLNSDGDTIQ 55
5566799********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 12.197 | 14 | 55 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 6.2E-11 | 21 | 55 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
MTDSSSSELP RVPRKEKNIK GQGRGRRIRV SAPCAARIFQ LTEDLGLNSD GDTIQ* |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017245424.1 | 8e-26 | PREDICTED: transcription factor TCP20-like | ||||
| TrEMBL | A0A166FZJ9 | 8e-32 | A0A166FZJ9_DAUCS; Uncharacterized protein | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA248 | 24 | 201 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45680.1 | 1e-13 | TCP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_000917 |




