![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_002324 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | ERF | ||||||||
| Protein Properties | Length: 141aa MW: 15791.6 Da PI: 8.3868 | ||||||||
| Description | ERF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | AP2 | 65.1 | 1.4e-20 | 23 | 75 | 2 | 56 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56
+y+GVr+++ +g+++AeIrd s+n ++r +lg+f taeeAa+a+++a+ +l+g+
DCAR_002324 23 RYRGVRRRP-WGKYAAEIRDSSQNR-QQRLWLGTFETAEEAARAYDKAAFNLKGH 75
6********.**********66653.6*************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00847 | 9.7E-15 | 23 | 75 | IPR001471 | AP2/ERF domain |
| SuperFamily | SSF54171 | 4.64E-21 | 23 | 83 | IPR016177 | DNA-binding domain |
| PROSITE profile | PS51032 | 23.96 | 23 | 82 | IPR001471 | AP2/ERF domain |
| CDD | cd00018 | 9.79E-28 | 23 | 82 | No hit | No description |
| Gene3D | G3DSA:3.30.730.10 | 9.3E-30 | 23 | 83 | IPR001471 | AP2/ERF domain |
| SMART | SM00380 | 2.4E-33 | 23 | 88 | IPR001471 | AP2/ERF domain |
| PRINTS | PR00367 | 1.3E-11 | 24 | 35 | IPR001471 | AP2/ERF domain |
| PRINTS | PR00367 | 1.3E-11 | 48 | 64 | IPR001471 | AP2/ERF domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 141 aa Download sequence Send to blast |
MEGSSKGKNA QENKGGTGSE EVRYRGVRRR PWGKYAAEIR DSSQNRQQRL WLGTFETAEE 60 AARAYDKAAF NLKGHLAILN FPREYYSKLP SYIYPPGPCS SVSPSSSVSD GKQIIEFEYL 120 DDSVMDELLE SEAEKIKSKK * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5wx9_A | 2e-34 | 16 | 140 | 7 | 130 | Ethylene-responsive transcription factor ERF096 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017223341.1 | 1e-100 | PREDICTED: ethylene-responsive transcription factor ERF098 | ||||
| Swissprot | Q9LTC5 | 4e-43 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
| TrEMBL | A0A166H3A8 | 2e-98 | A0A166H3A8_DAUCS; Uncharacterized protein | ||||
| STRING | XP_009590142.1 | 3e-47 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA21 | 24 | 1165 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G23230.1 | 2e-33 | ERF family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_002324 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




