![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_002460 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 157aa MW: 17804.8 Da PI: 6.5145 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 164.3 | 1.6e-51 | 20 | 114 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
eqd++lPianv+rimk++lPanaki+k+ ket+qecvsefisfvt+eas+kc++e+rkt+ngdd++wa+ lGf++y++plk yl +yre+eg++
DCAR_002460 20 EQDQLLPIANVARIMKEILPANAKIAKEGKETMQECVSEFISFVTGEASEKCRKERRKTVNGDDIVWAIDRLGFDNYAQPLKRYLDRYREIEGDH 114
8*******************************************************************************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.1E-48 | 19 | 121 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.42E-37 | 21 | 116 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.1E-25 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.4E-18 | 52 | 70 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 5.4E-18 | 71 | 89 | No hit | No description |
| PRINTS | PR00615 | 5.4E-18 | 90 | 108 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 157 aa Download sequence Send to blast |
MTSKNSGAAG SSSKPPQPYE QDQLLPIANV ARIMKEILPA NAKIAKEGKE TMQECVSEFI 60 SFVTGEASEK CRKERRKTVN GDDIVWAIDR LGFDNYAQPL KRYLDRYREI EGDHRANMNI 120 VHDRVGYDHE GNGRFHLYVK DAQQDRMDDN HPNGDH* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-44 | 20 | 109 | 3 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-44 | 20 | 109 | 3 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017256989.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 2e-49 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | Q9FGJ3 | 6e-49 | NFYB2_ARATH; Nuclear transcription factor Y subunit B-2 | ||||
| TrEMBL | A0A169WR86 | 1e-114 | A0A169WR86_DAUCS; Uncharacterized protein | ||||
| STRING | POPTR_0008s22520.1 | 3e-55 | (Populus trichocarpa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 2e-51 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_002460 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




