![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_003339 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 114aa MW: 12833.5 Da PI: 6.9331 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 156.2 | 5.7e-49 | 3 | 98 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
+e+dr+lPianv+rimk++lPanakisk+aket+qec+sefisfvt easdkc++e+rkt+ngdd++wal++lG+++++e+ yl k+re+e+e+
DCAR_003339 3 EEHDRLLPIANVGRIMKQILPANAKISKEAKETIQECASEFISFVTVEASDKCHKENRKTVNGDDICWALGSLGLDHHAEATGRYLYKFREFERER 98
799******************************************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 8.7E-45 | 2 | 106 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.26E-33 | 6 | 104 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.5E-27 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 8.1E-14 | 36 | 54 | No hit | No description |
| PRINTS | PR00615 | 8.1E-14 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 8.1E-14 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MVEEHDRLLP IANVGRIMKQ ILPANAKISK EAKETIQECA SEFISFVTVE ASDKCHKENR 60 KTVNGDDICW ALGSLGLDHH AEATGRYLYK FREFERERAN QSKAITAGRE QKD* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 6e-39 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 6e-39 | 2 | 93 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00133 | DAP | Transfer from AT1G09030 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC235914 | 1e-33 | AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017252665.1 | 2e-80 | PREDICTED: nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 2e-53 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A162B6P2 | 5e-79 | A0A162B6P2_DAUCS; Uncharacterized protein | ||||
| STRING | cassava4.1_026425m | 1e-58 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 7e-56 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_003339 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




