![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_003855 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 151aa MW: 16903.9 Da PI: 9.5201 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 103.5 | 1.9e-32 | 56 | 112 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++I++RRq+Rak+e+e+k ksrkpylheSRh+hAlrR+Rg+gGrF
DCAR_003855 56 EEPVFVNAKQYHGIMRRRQSRAKAESENKA-LKSRKPYLHESRHQHALRRARGNGGRF 112
69***************************9.9*************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.9E-35 | 54 | 115 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 37.331 | 55 | 115 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 1.1E-27 | 57 | 112 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 5.6E-24 | 58 | 80 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 60 | 80 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 5.6E-24 | 89 | 112 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 151 aa Download sequence Send to blast |
MGQAAYPYPD PYYRSIFAPY DTQPYPAQPY PAQPMVHLQL MGIQQAGVPL PSDAVEEPVF 60 VNAKQYHGIM RRRQSRAKAE SENKALKSRK PYLHESRHQH ALRRARGNGG RFLNAKKDEN 120 QQSEASSDRS QANINLNSDK IDVASSDSCC * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 2e-21 | 55 | 120 | 1 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM422775 | 2e-57 | AM422775.1 Antirrhinum majus mRNA for YA6 (nf-YA gene). | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017230574.1 | 1e-108 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
| Swissprot | Q84JP1 | 4e-60 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A166IJK4 | 1e-107 | A0A166IJK4_DAUCS; Uncharacterized protein | ||||
| STRING | XP_008225593.1 | 8e-88 | (Prunus mume) | ||||
| STRING | EMJ13270 | 8e-88 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA6650 | 23 | 33 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.2 | 2e-58 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_003855 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




