PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

DCAR_006190

Organism

Daucus carota

Taxonomic ID

4039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus

Family

YABBY

Protein Properties

Length: 106aa MW: 12171.7 Da PI: 9.3079

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
DCAR_006190	genome	ARS-USDA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	22.2	4e-07	5	25	3	23
YABBY 3 vfssseqvCyvqCnfCntila 23 ++ sse+vCy++C+fCnt+la DCAR_006190 5 ITISSERVCYLHCTFCNTVLA 25 6779****************8 PP
2	YABBY	100	5.2e-31	34	78	126	170
YABBY 126 PsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 saynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl DCAR_006190 34 LSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 78 49*****************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.30.10	5.4E-5	34	72	IPR009071	High mobility group box domain
SuperFamily	SSF47095	1.4E-6	34	71	IPR009071	High mobility group box domain
Pfam	PF04690	2.4E-29	35	78	IPR006780	YABBY protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MSTEITISSE RVCYLHCTFC NTVLAHQRRD NVFLSAYNRF IKEEIQRIKA SNPDISHREA 60 FSTAAKNWAH FPHIHFGLTR DSNKQAKLDH AMTSGEAQRS RPSFY*

Functional Description ? help Back to Top
Source	Description
UniProt	Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269\|PubMed:19837869}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT053393	5e-39	BT053393.1 Medicago truncatula clone MTYFP_FQ_FR_FS1G-O-9 unknown mRNA.
GenBank	BT136096	5e-39	BT136096.1 Medicago truncatula clone JCVI-FLMt-10K9 unknown mRNA.
GenBank	BT143893	5e-39	BT143893.1 Medicago truncatula clone JCVI-FLMt-10P10 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017232805.1	2e-46	PREDICTED: LOW QUALITY PROTEIN: putative axial regulator YABBY 2
Swissprot	Q8GW46	3e-29	YAB5_ARATH; Axial regulator YABBY 5
TrEMBL	A0A162ASN3	1e-73	A0A162ASN3_DAUCS; Uncharacterized protein
STRING	cassava4.1_016957m	3e-33	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA381	24	163

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G26580.2	1e-31	YABBY family protein

Link Out ? help Back to Top
Phytozome	DCAR_006190

Publications ? help Back to Top
Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity. Plant Cell, 2015. 27(12): p. 3321-35 [PMID:26589551]