![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_009674 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 91aa MW: 10313.8 Da PI: 10.1971 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 58.1 | 1.2e-18 | 20 | 54 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++C + kTp+WR gp g+ktLCnaCG++y++ +l
DCAR_009674 20 CTHCLSQKTPQWRAGPLGPKTLCNACGVRYKSGRL 54
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50114 | 12.163 | 14 | 50 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 4.1E-16 | 14 | 68 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 1.81E-16 | 15 | 77 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 1.0E-14 | 17 | 52 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 6.92E-12 | 19 | 66 | No hit | No description |
| Pfam | PF00320 | 2.0E-16 | 20 | 54 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 20 | 45 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MMEIQEESLE DRNGQQGRRC THCLSQKTPQ WRAGPLGPKT LCNACGVRYK SGRLLPEYRP 60 AKSPTFVSYK HSNSHKKVLE MRTMSHLSSH * |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). Transcription activator involved in xylem formation. Functions upstream of NAC030/VND7, a master switch of xylem vessel differentiation (PubMed:25265867). {ECO:0000250|UniProtKB:Q8LAU9, ECO:0000269|PubMed:25265867}. | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017241021.1 | 3e-61 | PREDICTED: GATA transcription factor 5-like | ||||
| Swissprot | O49741 | 4e-36 | GATA2_ARATH; GATA transcription factor 2 | ||||
| Swissprot | O49743 | 2e-36 | GATA4_ARATH; GATA transcription factor 4 | ||||
| Swissprot | O82632 | 6e-36 | GATA9_ARATH; GATA transcription factor 9 | ||||
| Swissprot | P69781 | 9e-36 | GAT12_ARATH; GATA transcription factor 12 | ||||
| TrEMBL | A0A166A9U1 | 3e-61 | A0A166A9U1_DAUCS; Uncharacterized protein | ||||
| STRING | XP_008812058.1 | 3e-43 | (Phoenix dactylifera) | ||||
| STRING | XP_010257696.1 | 3e-43 | (Nelumbo nucifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA15155 | 5 | 8 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G60530.1 | 1e-38 | GATA transcription factor 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_009674 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




