PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

DCAR_011129

Organism

Daucus carota

Taxonomic ID

4039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus

Family

ZF-HD

Protein Properties

Length: 92aa MW: 9794.9 Da PI: 7.2482

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
DCAR_011129	genome	ARS-USDA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	81.9	7.4e-26	33	86	4	57
ZF-HD_dimer 4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 v+Y eC+kN A Ggh+vDGC+Ef++s+geeg +++l C ACgC R+FHR+ v DCAR_011129 33 VTYLECRKNVAQGAGGHVVDGCQEFIASPGEEGAPSTLICGACGCNRSFHRKLV 86 89*************************************************965 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04770	1.7E-22	33	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDom	PD125774	4.0E-13	33	86	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.3E-22	34	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	20.899	35	85	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MRSSNPREES VNRLNPRGNG DNENFVNTRA TIVTYLECRK NVAQGAGGHV VDGCQEFIAS 60 PGEEGAPSTL ICGACGCNRS FHRKLVTVLS E*

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.
UniProt	Putative transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008353421.1	2e-18	mini zinc finger protein 2-like
Refseq	XP_008379352.1	2e-18	mini zinc finger protein 2
Swissprot	Q9LJW5	8e-17	MIF2_ARATH; Mini zinc finger protein 2
Swissprot	Q9ZPW7	2e-15	ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBL	A0A161WUG1	3e-60	A0A161WUG1_DAUCS; Uncharacterized protein
STRING	XP_008353421.1	7e-18	(Malus domestica)
STRING	XP_008379352.1	8e-18	(Malus domestica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	3e-19	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	DCAR_011129

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]