| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF822 | 207.2 | 4.6e-64 | 19 | 159 | 1 | 137 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl....eeaeaagssasaspessl 94
gg++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGn++lpk++DnneVlkALc++AGw+ve+DGtty+kgs+p+ +++++g+s++++p+ss
DCAR_012749 19 GGGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNFNLPKHCDNNEVLKALCAQAGWTVEPDGTTYPKGSRPPsidiASMDIGGTSNNTTPCSSR 116
689************************************************************************9999889**************** PP
DUF822 95 qsslkssalaspvesysaspksssfpspssldsislasaasll 137
s+ ss+++sp++sy++sp+sssfpsps+l+ +++++ s++
DCAR_012749 117 RPSPPSSSFPSPIPSYQPSPTSSSFPSPSRLEPHMSSNPFSFM 159
*******************************999887664333 PP
|
| 2 | DUF822 | 207.3 | 4.2e-64 | 211 | 351 | 1 | 137 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl....eeaeaagssasaspessl 94
gg++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGn++lpk++DnneVlkALc++AGw+ve+DGtty+kgs+p+ +++++g+s++++p+ss
DCAR_012749 211 GGGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNFNLPKHCDNNEVLKALCAQAGWTVEPDGTTYPKGSRPPsidiASMDIGGTSNNTTPCSSR 308
689************************************************************************9999889**************** PP
DUF822 95 qsslkssalaspvesysaspksssfpspssldsislasaasll 137
s+ ss+++sp++sy++sp+sssfpsps+l+ +++++ s++
DCAR_012749 309 RPSPPSSSFPSPIPSYQPSPTSSSFPSPSRLEPHMSSNPFSFM 351
********************************99887663333 PP
|
| Publications
? help Back to Top |
- Wang H, et al.
Dual role of BKI1 and 14-3-3 s in brassinosteroid signaling to link receptor with transcription factors. Dev. Cell, 2011. 21(5): p. 825-34 [PMID:22075146] - Liu L, et al.
Ectopic expression of a BZR1-1D transcription factor in brassinosteroid signalling enhances carotenoid accumulation and fruit quality attributes in tomato. Plant Biotechnol. J., 2014. 12(1): p. 105-15 [PMID:24102834] - Kim B, et al.
Darkness and gulliver2/phyB mutation decrease the abundance of phosphorylated BZR1 to activate brassinosteroid signaling in Arabidopsis. Plant J., 2014. 77(5): p. 737-47 [PMID:24387668] - He X, et al.
A genotypic difference in primary root length is associated with the inhibitory role of transforming growth factor-beta receptor-interacting protein-1 on root meristem size in wheat. Plant J., 2014. 77(6): p. 931-43 [PMID:24467344] - Oh E, et al.
Cell elongation is regulated through a central circuit of interacting transcription factors in the Arabidopsis hypocotyl. Elife, 2015. [PMID:24867218] - Zhang D,Jing Y,Jiang Z,Lin R
The Chromatin-Remodeling Factor PICKLE Integrates Brassinosteroid and Gibberellin Signaling during Skotomorphogenic Growth in Arabidopsis. Plant Cell, 2014. 26(6): p. 2472-2485 [PMID:24920333] - Shimada S, et al.
Formation and dissociation of the BSS1 protein complex regulates plant development via brassinosteroid signaling. Plant Cell, 2015. 27(2): p. 375-90 [PMID:25663622] - Chaiwanon J,Wang ZY
Spatiotemporal brassinosteroid signaling and antagonism with auxin pattern stem cell dynamics in Arabidopsis roots. Curr. Biol., 2015. 25(8): p. 1031-42 [PMID:25866388] - Zhang Y, et al.
Brassinosteroid is required for sugar promotion of hypocotyl elongation in Arabidopsis in darkness. Planta, 2015. 242(4): p. 881-93 [PMID:25998528] - Jiang J, et al.
The Intrinsically Disordered Protein BKI1 Is Essential for Inhibiting BRI1 Signaling in Plants. Mol Plant, 2015. 8(11): p. 1675-8 [PMID:26296798] - Zhang Y,He J
Sugar-induced plant growth is dependent on brassinosteroids. Plant Signal Behav, 2015. 10(12): p. e1082700 [PMID:26340221] - Anne P, et al.
OCTOPUS Negatively Regulates BIN2 to Control Phloem Differentiation in Arabidopsis thaliana. Curr. Biol., 2015. 25(19): p. 2584-90 [PMID:26387715] - Wang R, et al.
The Brassinosteroid-Activated BRI1 Receptor Kinase Is Switched off by Dephosphorylation Mediated by Cytoplasm-Localized PP2A B' Subunits. Mol Plant, 2016. 9(1): p. 148-157 [PMID:26517938] - Youn JH, et al.
ARF7 increases the endogenous contents of castasterone through suppression of BAS1 expression in Arabidopsis thaliana. Phytochemistry, 2016. 122: p. 34-44 [PMID:26608667] - Chaiwanon J,Garcia VJ,Cartwright H,Sun Y,Wang ZY
Immunophilin-like FKBP42/TWISTED DWARF1 Interacts with the Receptor Kinase BRI1 to Regulate Brassinosteroid Signaling in Arabidopsis. Mol Plant, 2016. 9(4): p. 593-600 [PMID:26808213] - Yang X,Bai Y,Shang J,Xin R,Tang W
The antagonistic regulation of abscisic acid-inhibited root growth by brassinosteroids is partially mediated via direct suppression of ABSCISIC ACID INSENSITIVE 5 expression by BRASSINAZOLE RESISTANT 1. Plant Cell Environ., 2016. 39(9): p. 1994-2003 [PMID:27149247] - Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] - Zhang Z, et al.
TOR Signaling Promotes Accumulation of BZR1 to Balance Growth with Carbon Availability in Arabidopsis. Curr. Biol., 2016. 26(14): p. 1854-60 [PMID:27345161] - Zhang Y, et al.
Functional characterization of GmBZL2 (AtBZR1 like gene) reveals the conserved BR signaling regulation in Glycine max. Sci Rep, 2016. 6: p. 31134 [PMID:27498784] - Favero DS,Le KN,Neff MM
Brassinosteroid signaling converges with SUPPRESSOR OF PHYTOCHROME B4-#3 to influence the expression of SMALL AUXIN UP RNA genes and hypocotyl growth. Plant J., 2017. 89(6): p. 1133-1145 [PMID:27984677] - Li H, et al.
BZR1 Positively Regulates Freezing Tolerance via CBF-Dependent and CBF-Independent Pathways in Arabidopsis. Mol Plant, 2017. 10(4): p. 545-559 [PMID:28089951] - Zentella R, et al.
The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA. Nat. Chem. Biol., 2017. 13(5): p. 479-485 [PMID:28244988] - Espinosa-Ruiz A, et al.
TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] - Li QF, et al.
Light involved regulation of BZR1 stability and phosphorylation status to coordinate plant growth in Arabidopsis. Biosci. Rep., 2018. [PMID:28396515] - Thussagunpanit J, et al.
Characterization of synthetic ecdysteroid analogues as functional mimics of brassinosteroids in plant growth. J. Steroid Biochem. Mol. Biol., 2017. 172: p. 1-8 [PMID:28479230] - Zhu JY, et al.
The F-box Protein KIB1 Mediates Brassinosteroid-Induced Inactivation and Degradation of GSK3-like Kinases in Arabidopsis. Mol. Cell, 2017. 66(5): p. 648-657.e4 [PMID:28575660] - Yang M,Wang X
Multiple Ways of BES1/BZR1 Degradation to Decode Distinct Developmental and Environmental Cues in Plants. Mol Plant, 2017. 10(7): p. 915-917 [PMID:28629641] - Lv B, et al.
Brassinosteroids regulate root growth by controlling reactive oxygen species homeostasis and dual effect on ethylene synthesis in Arabidopsis. PLoS Genet., 2018. 14(1): p. e1007144 [PMID:29324765] - IbaƱez C, et al.
Brassinosteroids Dominate Hormonal Regulation of Plant Thermomorphogenesis via BZR1. Curr. Biol., 2018. 28(2): p. 303-310.e3 [PMID:29337075] - Saito M,Kondo Y,Fukuda H
BES1 and BZR1 Redundantly Promote Phloem and Xylem Differentiation. Plant Cell Physiol., 2018. 59(3): p. 590-600 [PMID:29385529] - Li QF, et al.
The brassinosteroid-regulated transcription factors BZR1/BES1 function as a coordinator in multisignal-regulated plant growth. Biochim Biophys Acta Gene Regul Mech, 2018. 1861(6): p. 561-571 [PMID:29673687] - Nosaki S, et al.
Structural basis for brassinosteroid response by BIL1/BZR1. Nat Plants, 2018. 4(10): p. 771-776 [PMID:30287951]
|