![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_019120 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 95aa MW: 10318.6 Da PI: 8.6822 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 80 | 3.2e-25 | 8 | 57 | 46 | 95 |
NF-YB 46 vtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+ + asdkcq+ekrktingddllwa+atlGfedy++plk+yl++yre ++
DCAR_019120 8 ILCRASDKCQKEKRKTINGDDLLWAMATLGFEDYIDPLKAYLARYREGDT 57
6789******************************************9665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-21 | 8 | 77 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.0E-6 | 8 | 33 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 3.31E-17 | 8 | 66 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 2.7E-10 | 16 | 34 | No hit | No description |
| PRINTS | PR00615 | 2.7E-10 | 35 | 53 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MEVSKGVILC RASDKCQKEK RKTINGDDLL WAMATLGFED YIDPLKAYLA RYREGDTKGS 60 ARGGEGSAKK DPIGSQLSSQ QYAHQGMGYV NSQV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 9e-17 | 6 | 54 | 46 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 9e-17 | 6 | 54 | 46 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017252060.1 | 9e-63 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
| Refseq | XP_017252061.1 | 9e-63 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
| Swissprot | Q67XJ2 | 1e-33 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | A0A164ZG44 | 2e-63 | A0A164ZG44_DAUCS; Uncharacterized protein | ||||
| STRING | VIT_13s0019g03600.t01 | 2e-40 | (Vitis vinifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 6e-36 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_019120 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




