![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_021802 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 116aa MW: 13536.2 Da PI: 9.9 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 101.1 | 6.5e-32 | 36 | 94 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk++ +pr+YY+Ct++gC+vkk+v+r ++d+++v++tYeg H+h+
DCAR_021802 36 LDDGYRWRKYGQKTVKNNAHPRNYYKCTYQGCSVKKQVQRLDKDETIVVTTYEGIHTHS 94
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 6.5E-34 | 21 | 94 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.57E-29 | 28 | 95 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.943 | 31 | 96 | IPR003657 | WRKY domain |
| SMART | SM00774 | 8.9E-37 | 36 | 95 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.0E-26 | 37 | 93 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MGTDDRNDEV KVDAKQKNKN KKQRFAFQTK SQVDILDDGY RWRKYGQKTV KNNAHPRNYY 60 KCTYQGCSVK KQVQRLDKDE TIVVTTYEGI HTHSIQKPSD DFQNILSEMK IFPTS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-28 | 26 | 95 | 7 | 76 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-28 | 26 | 95 | 7 | 76 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017257414.1 | 7e-82 | PREDICTED: probable WRKY transcription factor 45 | ||||
| Swissprot | Q9S763 | 1e-45 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
| TrEMBL | A0A161XDQ7 | 2e-80 | A0A161XDQ7_DAUCS; Uncharacterized protein | ||||
| STRING | Solyc02g094270.1.1 | 2e-51 | (Solanum lycopersicum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2204 | 24 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G01970.1 | 9e-48 | WRKY DNA-binding protein 45 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_021802 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




