PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

DCAR_023571

Organism

Daucus carota

Taxonomic ID

4039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus

Family

HSF

Protein Properties

Length: 56aa MW: 6168.85 Da PI: 3.7928

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
DCAR_023571	genome	ARS-USDA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	39.6	1.4e-12	12	53	2	43
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHH CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpk 43 Fl+klye+++de+++ lisw ++++sfv++d ef++ +Lp+ DCAR_023571 12 FLTKLYEMVDDETTDGLISWGSRNDSFVIWDDVEFSTVLLPN 53 9************************************99987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	2.5E-13	4	53	IPR011991	Winged helix-turn-helix DNA-binding domain
SuperFamily	SSF46785	4.42E-12	8	52	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	2.5E-9	12	53	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 56 aa Download sequence Send to blast
MGKKTAGDVA PFLTKLYEMV DDETTDGLIS WGSRNDSFVI WDDVEFSTVL LPNNE*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017215745.1	3e-29	PREDICTED: heat stress transcription factor A-8-like
Swissprot	Q94BZ5	2e-11	HSFA5_ARATH; Heat stress transcription factor A-5
TrEMBL	A0A161WQ37	5e-32	A0A161WQ37_DAUCS; Uncharacterized protein
STRING	XP_006469269.1	3e-14	(Citrus sinensis)
STRING	XP_006448138.1	3e-14	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA572	24	113

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G16820.2	1e-13	heat shock factor 3

Link Out ? help Back to Top
Phytozome	DCAR_023571

Publications ? help Back to Top
Reňák D,Gibalová A,Solcová K,Honys D A new link between stress response and nucleolar function during pollen development in Arabidopsis mediated by AtREN1 protein. Plant Cell Environ., 2014. 37(3): p. 670-83 [PMID:23961845]