PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

DCAR_027083

Organism

Daucus carota

Taxonomic ID

4039

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus

Family

NF-YB

Protein Properties

Length: 117aa MW: 12973.5 Da PI: 4.7713

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
DCAR_027083	genome	ARS-USDA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	147.6	2.7e-46	18	111	3	96
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 eqd +lPianv+rimk+ lPanak+sk++ket+qecvsefi fvt+eas++c+rekrk ++gdd++ a+ tlGf++y+ ++k yl+kyr+ eg DCAR_027083 18 EQDLLLPIANVGRIMKQNLPANAKVSKESKETMQECVSEFICFVTEEASERCRREKRKILSGDDICGAMQTLGFDNYAGTMKRYLEKYRQSEGG 111 89****************************************************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.1E-46	11	114	IPR009072	Histone-fold
SuperFamily	SSF47113	1.71E-34	19	113	IPR009072	Histone-fold
Pfam	PF00808	9.3E-24	23	86	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	4.4E-14	50	68	No hit	No description
PRINTS	PR00615	4.4E-14	69	87	No hit	No description
PRINTS	PR00615	4.4E-14	88	106	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MADNSGDSAS NNDQSVPEQD LLLPIANVGR IMKQNLPANA KVSKESKETM QECVSEFICF 60 VTEEASERCR REKRKILSGD DICGAMQTLG FDNYAGTMKR YLEKYRQSEG GRANQE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-38	18	107	3	92	Transcription factor HapC (Eurofung)
4g92_B	1e-38	18	107	3	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017221717.1	3e-82	PREDICTED: nuclear transcription factor Y subunit B-5-like
Swissprot	O82248	1e-46	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A175YPG0	7e-81	A0A175YPG0_DAUCS; Uncharacterized protein
STRING	cassava4.1_018746m	4e-54	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	4e-49	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	DCAR_027083

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]