![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_028373 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 159aa MW: 17960.4 Da PI: 5.7206 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 157 | 3.1e-49 | 2 | 96 | 1 | 95 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
vreqd f+Pianv+rim+k++P++akis+daket+qe vsefisfvtsea+ +cq+e+r+ti+++d+lwa+ +lGf+dy+epl+vyl++ re+e+
DCAR_028373 2 VREQDMFMPIANVIRIMRKIMPSHAKISDDAKETIQESVSEFISFVTSEANMRCQQEQRRTITAEDVLWAMNNLGFDDYIEPLTVYLNRMREIEN 96
69*******************************************************************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.0E-46 | 2 | 98 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.54E-37 | 5 | 98 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.8E-25 | 7 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.9E-15 | 36 | 54 | No hit | No description |
| PRINTS | PR00615 | 4.9E-15 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 4.9E-15 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0033613 | Molecular Function | activating transcription factor binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 159 aa Download sequence Send to blast |
MVREQDMFMP IANVIRIMRK IMPSHAKISD DAKETIQESV SEFISFVTSE ANMRCQQEQR 60 RTITAEDVLW AMNNLGFDDY IEPLTVYLNR MREIENGEPF RSDLLLRRSL EHRAMGIATS 120 FTPPYYMGLH NGTSGVMTTE GFLKDARNAG STSGARGT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 6e-53 | 2 | 93 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB120105 | 1e-134 | AB120105.1 Daucus carota DcLEC1e mRNA for HAP3 like CCAAT box binding protein, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017222301.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit B-6 | ||||
| Swissprot | Q84W66 | 3e-52 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A175YLI6 | 1e-115 | A0A175YLI6_DAUCS; Uncharacterized protein | ||||
| STRING | VIT_00s0956g00020.t01 | 1e-64 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 9e-55 | nuclear factor Y, subunit B6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_028373 |




