![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_031125 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 88aa MW: 10535 Da PI: 9.4749 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 30 | 9e-10 | 29 | 63 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
k +yp+++++ LA+++gL+++q+ +WF N+R ++
DCAR_031125 29 KWPYPTEADKNFLAESTGLDQKQINNWFINQRKRH 63
569*****************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 12.309 | 3 | 66 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 2.05E-20 | 4 | 79 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 1.4E-12 | 5 | 70 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-28 | 9 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 4.86E-11 | 15 | 67 | No hit | No description |
| Pfam | PF05920 | 3.1E-18 | 23 | 62 | IPR008422 | Homeobox KN domain |
| PROSITE pattern | PS00027 | 0 | 41 | 64 | IPR017970 | Homeobox, conserved site |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MEFSKKKQKG KLPKEARDML LDWWKVHYKW PYPTEADKNF LAESTGLDQK QINNWFINQR 60 KRHWKPSEEM QLAVMDSISG QFYPTDD* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017224027.1 | 6e-59 | PREDICTED: homeobox protein knotted-1-like 6 isoform X1 | ||||
| Refseq | XP_017224028.1 | 6e-59 | PREDICTED: homeobox protein knotted-1-like 6 isoform X2 | ||||
| Swissprot | Q84JS6 | 3e-37 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
| TrEMBL | A0A175YIL8 | 2e-58 | A0A175YIL8_DAUCS; Uncharacterized protein | ||||
| STRING | EOY00544 | 1e-41 | (Theobroma cacao) | ||||
| STRING | XP_010100424.1 | 2e-41 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA753 | 24 | 80 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G23380.1 | 1e-39 | KNOTTED1-like homeobox gene 6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_031125 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




