![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | DCAR_032121 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 105aa MW: 11859.4 Da PI: 8.2232 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 61 | 2.2e-19 | 13 | 51 | 21 | 59 |
-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
r+YYrCt+++Cpvkk+vers edp++v++tYeg+Hnh+
DCAR_032121 13 CRGYYRCTTQKCPVKKHVERSFEDPSIVITTYEGSHNHH 51
69************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 1.4E-10 | 1 | 52 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.48E-15 | 12 | 53 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 1.1E-17 | 13 | 53 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.9E-13 | 13 | 51 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 19.152 | 14 | 53 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MLSKCIYPKF GICRGYYRCT TQKCPVKKHV ERSFEDPSIV ITTYEGSHNH HLPASLRANL 60 SIGSPSFLSP LNYPIHECYE DTNGTTRSND YLQHSLTLGP LQHF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-13 | 14 | 54 | 38 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-13 | 14 | 54 | 38 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012830503.1 | 1e-22 | PREDICTED: probable WRKY transcription factor 71 | ||||
| Refseq | XP_022142261.1 | 1e-22 | probable WRKY transcription factor 71 | ||||
| Refseq | XP_027088028.1 | 1e-22 | WRKY transcription factor 28-like | ||||
| Refseq | XP_027185582.1 | 1e-22 | WRKY transcription factor 28-like | ||||
| TrEMBL | A0A175YA78 | 7e-72 | A0A175YA78_DAUCS; Uncharacterized protein | ||||
| STRING | Migut.H01387.1.p | 5e-22 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1485 | 24 | 75 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29860.1 | 2e-20 | WRKY DNA-binding protein 71 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | DCAR_032121 |




