PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Dca50873.1

Organism

Dianthus caryophyllus

Taxonomic ID

3570

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus

Family

NAC

Protein Properties

Length: 150aa MW: 17359.1 Da PI: 9.99

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Dca50873.1	genome	DCA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	168.1	3e-52	12	136	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 lppGfrFhPtd+elv++yL k ++++ +l + evd++k+ePwdLp+++ + kewyf+s+rd+kyatg r+nrat sgyWkatgkd++v++ +g+ Dca50873.1 12 LPPGFRFHPTDDELVCDYLLLKWNASHSPL---LIEVDLNKCEPWDLPERACIGGKEWYFYSQRDRKYATGLRTNRATVSGYWKATGKDRAVVR-RGNM 106 79*********************99888...779********8777899***********************************9.999 PP NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129 vg++ktLvfy+grapkg+kt+Wvmhe+rle Dca50873.1 107 VGMRKTLVFYQGRAPKGHKTQWVMHEFRLE 136 ***************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.1E-55	2	143	IPR003441	NAC domain
PROSITE profile	PS51005	49.448	12	150	IPR003441	NAC domain
Pfam	PF02365	5.9E-27	13	135	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MMSSLSMVEA KLPPGFRFHP TDDELVCDYL LLKWNASHSP LLIEVDLNKC EPWDLPERAC 60 IGGKEWYFYS QRDRKYATGL RTNRATVSGY WKATGKDRAV VRRGNMVGMR KTLVFYQGRA 120 PKGHKTQWVM HEFRLEPPFV PNNLIPSPSK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-50	6	135	9	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269\|PubMed:11114891}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by auxin.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021722881.1	6e-88	NAC domain-containing protein 21/22-like isoform X1
Refseq	XP_021733704.1	5e-88	NAC domain-containing protein 21/22-like isoform X1
Swissprot	Q84TE6	2e-76	NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBL	A0A0J8B8I0	2e-84	A0A0J8B8I0_BETVU; Uncharacterized protein
TrEMBL	A0A0J8DZI6	2e-84	A0A0J8DZI6_BETVU; Uncharacterized protein
STRING	XP_010666180.1	3e-85	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G56010.2	8e-79	NAC domain containing protein 1

Publications ? help Back to Top
Le Hénanff G, et al. Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance. J. Exp. Bot., 2013. 64(16): p. 4877-93 [PMID:24043850] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Huo X,Wang C,Teng Y,Liu X Identification of miRNAs associated with dark-induced senescence in Arabidopsis. BMC Plant Biol., 2015. 15: p. 266 [PMID:26530097] Chen X, et al. Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis. Plant Physiol., 2016. 170(4): p. 2136-45 [PMID:26850273] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]