![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Dca5456.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 88aa MW: 9820.52 Da PI: 4.9066 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 66.3 | 6e-21 | 11 | 84 | 3 | 76 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGf 76
++d+ lP a +++i+k++lPa+ ++++da++++ ec +efi +v+se+++ c++e++kti+++ +l al G+
Dca5456.1 11 KEDASLPKATMTKIIKEMLPAEVRVARDAQDLLIECCVEFINLVSSESNEVCNKEEKKTIAPEHVLKALEGKGY 84
6899****************************************************************988776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 7.9E-29 | 8 | 84 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 9.22E-26 | 12 | 83 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 6.1E-23 | 14 | 79 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MEPMDIVGKT KEDASLPKAT MTKIIKEMLP AEVRVARDAQ DLLIECCVEF INLVSSESNE 60 VCNKEEKKTI APEHVLKALE GKGYAMLR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1jfi_B | 2e-26 | 12 | 85 | 12 | 84 | Transcription Regulator NC2 beta chain |
| Search in ModeBase | ||||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022886353.1 | 1e-50 | protein Dr1 homolog | ||||
| Refseq | XP_022886354.1 | 1e-50 | protein Dr1 homolog | ||||
| Swissprot | P49592 | 9e-49 | NC2B_ARATH; Protein Dr1 homolog | ||||
| TrEMBL | A0A2R6QI52 | 1e-48 | A0A2R6QI52_ACTCH; Protein Dr1 like | ||||
| STRING | Bo8g004650.1 | 1e-48 | (Brassica oleracea) | ||||
| STRING | Bo9g174680.1 | 1e-48 | (Brassica oleracea) | ||||
| STRING | Bo9g174690.1 | 1e-48 | (Brassica oleracea) | ||||
| STRING | XP_010491444.1 | 1e-48 | (Camelina sativa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G08190.1 | 1e-52 | nuclear factor Y, subunit B12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




