| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 82.8 | 2.2e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
kri+n + rqvtfskRr g++KKA+ELS+LCdae+ +i+fsstgkl++yss
Dca56094.1 9 KRIDNVTARQVTFSKRRRGLIKKAQELSTLCDAEIGLIVFSSTGKLFDYSS 59
79***********************************************96 PP
|
| 2 | K-box | 36.1 | 2.8e-13 | 95 | 170 | 23 | 98 |
K-box 23 kLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
L++e++ ++ hl G++Le ++l+eL +Le+q+e+s +k + K e l++++ +l+ k +l++en++L++++
Dca56094.1 95 LLNNELKDKTQQVSHLNGDELEAMNLEELIRLERQVERSQSKLHKAKGEKLRKELATLKGKDAQLSRENQRLKEQM 170
55666666667889***********************************************************987 PP
|
| Protein Features
? help Back to Top |
 |
| Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
| SMART | SM00432 | 1.7E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.072 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.78E-37 | 3 | 70 | No hit | No description |
| SuperFamily | SSF55455 | 2.88E-28 | 3 | 72 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.1E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.0E-23 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.1E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 7.1E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 9.772 | 86 | 176 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 8.9E-10 | 95 | 170 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0000060 | Biological Process | protein import into nucleus, translocation |
| GO:0009739 | Biological Process | response to gibberellin |
| GO:0010076 | Biological Process | maintenance of floral meristem identity |
| GO:0010077 | Biological Process | maintenance of inflorescence meristem identity |
| GO:0010220 | Biological Process | positive regulation of vernalization response |
| GO:0010582 | Biological Process | floral meristem determinacy |
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
| GO:0048438 | Biological Process | floral whorl development |
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase |
| GO:0005634 | Cellular Component | nucleus |
| GO:0005737 | Cellular Component | cytoplasm |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0042803 | Molecular Function | protein homodimerization activity |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| GO:0046982 | Molecular Function | protein heterodimerization activity |