PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Dca7416.1

Organism

Dianthus caryophyllus

Taxonomic ID

3570

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus

Family

NAC

Protein Properties

Length: 155aa MW: 18096.9 Da PI: 10.0668

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Dca7416.1	genome	DCA	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	144.9	4.3e-45	10	138	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lppGfrFhPtdeel ++yLk+kv gk+l ++++e+d++++ Pw+Lp k ++k+++ +wyf ++r+k+y+++ r++ra ++g+Wk+tg+d++v k++ Dca7416.1 10 LPPGFRFHPTDEELFMFYLKRKVLGKSLGP-QMMTEIDVFHHAPWELPsKaCLKTKDLNWYFMCPRNKRYPSSGRSSRASEHGFWKSTGTDRTVNY-KNR 107 79***********************988.88**********96347778888*********************************9.899 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrle 129 vg ktL+f++g+apkge+tdWvmheyrle Dca7416.1 108 PVGKIKTLIFHRGKAPKGERTDWVMHEYRLE 138 9**************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.92E-53	4	155	IPR003441	NAC domain
PROSITE profile	PS51005	50.348	10	155	IPR003441	NAC domain
Pfam	PF02365	3.5E-24	11	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 155 aa Download sequence Send to blast
MDALLGSKVL PPGFRFHPTD EELFMFYLKR KVLGKSLGPQ MMTEIDVFHH APWELPSKAC 60 LKTKDLNWYF MCPRNKRYPS SGRSSRASEH GFWKSTGTDR TVNYKNRPVG KIKTLIFHRG 120 KAPKGERTDW VMHEYRLEDR MLLEQGVAQD SYVIC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	8e-45	10	155	17	160	NO APICAL MERISTEM PROTEIN
1ut4_B	8e-45	10	155	17	160	NO APICAL MERISTEM PROTEIN
1ut7_A	8e-45	10	155	17	160	NO APICAL MERISTEM PROTEIN
1ut7_B	8e-45	10	155	17	160	NO APICAL MERISTEM PROTEIN
3swm_A	7e-45	10	155	20	163	NAC domain-containing protein 19
3swm_B	7e-45	10	155	20	163	NAC domain-containing protein 19
3swm_C	7e-45	10	155	20	163	NAC domain-containing protein 19
3swm_D	7e-45	10	155	20	163	NAC domain-containing protein 19
3swp_A	7e-45	10	155	20	163	NAC domain-containing protein 19
3swp_B	7e-45	10	155	20	163	NAC domain-containing protein 19
3swp_C	7e-45	10	155	20	163	NAC domain-containing protein 19
3swp_D	7e-45	10	155	20	163	NAC domain-containing protein 19
4dul_A	8e-45	10	155	17	160	NAC domain-containing protein 19
4dul_B	8e-45	10	155	17	160	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250\|UniProtKB:Q9C8W9}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010674451.1	4e-88	PREDICTED: NAC domain-containing protein 82
Refseq	XP_021862009.1	6e-88	NAC domain-containing protein 82-like
Swissprot	Q9FY82	8e-55	NAC82_ARATH; NAC domain-containing protein 82
TrEMBL	A0A0K9RG69	1e-86	A0A0K9RG69_SPIOL; Uncharacterized protein
STRING	XP_010674451.1	2e-87	(Beta vulgaris)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64060.1	5e-64	NAC domain containing protein 103

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Deeken R, et al. Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments. Plant J., 2008. 55(5): p. 746-59 [PMID:18485061] Ohbayashi I, et al. Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis. Plant Cell, 2017. 29(10): p. 2644-2660 [PMID:28899981]