![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Do003758.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 62aa MW: 7003.49 Da PI: 11.0765 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 68.1 | 8.5e-22 | 10 | 53 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
+ en+s r vt+skRr gi KKA+ELS+LCd++ +++fs+tgk
Do003758.1 10 KLENNSGRVVTYSKRRSGIVKKAKELSILCDIDLILLMFSPTGK 53
679***************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 3.1E-27 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.31E-22 | 1 | 57 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 23.464 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-17 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.6E-19 | 11 | 54 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-17 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-17 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010152 | Biological Process | pollen maturation | ||||
| GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MGRVKLKIKK LENNSGRVVT YSKRRSGIVK KAKELSILCD IDLILLMFSP TGKPTICIGE 60 RR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Do003758.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021317426.1 | 6e-33 | agamous-like MADS-box protein AGL65 isoform X1 | ||||
| Refseq | XP_021317427.1 | 6e-33 | agamous-like MADS-box protein AGL65 isoform X1 | ||||
| Refseq | XP_021317428.1 | 4e-33 | agamous-like MADS-box protein AGL65 isoform X2 | ||||
| Swissprot | Q1PFA4 | 7e-26 | AGL30_ARATH; Agamous-like MADS-box protein AGL30 | ||||
| TrEMBL | A0A1E5UTZ6 | 1e-35 | A0A1E5UTZ6_9POAL; Uncharacterized protein | ||||
| STRING | Sb05g025970.1 | 1e-32 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4626 | 36 | 59 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03060.1 | 3e-18 | AGAMOUS-like 30 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




