PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Do004107.1

Organism

Dichanthelium oligosanthes

Taxonomic ID

888268

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

MIKC_MADS

Protein Properties

Length: 289aa MW: 32971.1 Da PI: 8.9979

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do004107.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.5	1.3e-31	63	113	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+ Do004107.1 63 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 113 79***********************************************95 PP
2	K-box	98.4	1.1e-32	131	228	4	100
K-box 4 ssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 ss ++e + ++++qe+a+L+++i nLq+++R l+G++++++s+k+L+qLe +L+k+l kiR++Kne+l++++e++q++e elq++n +Lr+++ee Do004107.1 131 SSAAGtVAEVTIQHYKQESARLRQQITNLQNSNRTLIGDSITTMSHKDLKQLEARLDKGLVKIRARKNEVLCSELEYMQRREMELQNDNLYLRSRVEE 228 44444689999***********************************************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.7E-40	55	114	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.221	55	115	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.53E-33	56	128	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.64E-45	56	129	No hit	No description
PRINTS	PR00404	9.4E-33	57	77	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	57	111	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-26	64	111	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.4E-33	77	92	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.4E-33	92	113	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	14.019	142	232	IPR002487	Transcription factor, K-box
Pfam	PF01486	7.0E-24	142	226	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048366	Biological Process	leaf development
GO:0048440	Biological Process	carpel development
GO:0048443	Biological Process	stamen development
GO:0048497	Biological Process	maintenance of floral organ identity
GO:0090376	Biological Process	seed trichome differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 289 aa Download sequence Send to blast
MHIQEEQQAT PSTDIMWGFS GQSTLTSTGL KLKEPEPLLS SPGSGSAGAA AAEKNGRGKI 60 EIKRIENTTN RQVTFCKRRN GLLKKAYELS VLCDAEVALI VFSSRGRLYE YSNNSVKATI 120 ERYKKATSDN SSAAGTVAEV TIQHYKQESA RLRQQITNLQ NSNRTLIGDS ITTMSHKDLK 180 QLEARLDKGL VKIRARKNEV LCSELEYMQR REMELQNDNL YLRSRVEENE RAQQTVNMME 240 APSTSEYQQG FIPYDPIRSF LQFNIMQQQP QFYSQQEDRK DFNFNFNLG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6bz1_A	2e-20	56	143	2	89	MEF2 CHIMERA
6bz1_B	2e-20	56	143	2	89	MEF2 CHIMERA
6bz1_C	2e-20	56	143	2	89	MEF2 CHIMERA
6bz1_D	2e-20	56	143	2	89	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00609	ChIP-seq	Transfer from AT4G18960	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do004107.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	MZEZAG1A	0.0	L18924.1 Corn ZAG1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004960599.1	0.0	MADS-box transcription factor 58
Swissprot	Q2V0P1	1e-132	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A1E5VH85	0.0	A0A1E5VH85_9POAL; MADS-box transcription factor 58 (Fragment)
STRING	Pavir.Ca00579.1.p	1e-178	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP649	37	144

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	4e-95	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]