![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Do009623.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 86aa MW: 9159.12 Da PI: 7.3404 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 98.2 | 6.2e-31 | 20 | 76 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
+ v+Y+eC++NhAas+Gg+avDGC+Efm+s g+egtaaal CaAC CHR+FHRreve
Do009623.1 20 KVVHYRECQRNHAASIGGYAVDGCREFMAS-GAEGTAAALICAACSCHRSFHRREVEA 76
5799*************************9.999*********************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 3.0E-21 | 19 | 85 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 2.4E-30 | 22 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 4.9E-26 | 23 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.696 | 24 | 73 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MGPQQDRSMA NGTASRKETK VVHYRECQRN HAASIGGYAV DGCREFMASG AEGTAAALIC 60 AACSCHRSFH RREVEADCDC SSTTSG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Do009623.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU968713 | 1e-48 | EU968713.1 Zea mays clone 323630 zinc finger homeodomain protein 1 mRNA, complete cds. | |||
| GenBank | EU976010 | 1e-48 | EU976010.1 Zea mays clone 508548 zinc finger homeodomain protein 1 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004978478.1 | 3e-53 | mini zinc finger protein 1 | ||||
| Swissprot | B8BIU8 | 2e-33 | MIF1_ORYSI; Mini zinc finger protein 1 | ||||
| Swissprot | Q2RB28 | 2e-33 | MIF1_ORYSJ; Mini zinc finger protein 1 | ||||
| TrEMBL | A0A1E5W9P5 | 5e-56 | A0A1E5W9P5_9POAL; Mini zinc finger protein 1 | ||||
| STRING | Si027403m | 1e-52 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1431 | 34 | 120 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 4e-30 | mini zinc finger 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




