PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do011549.1
Organism
Dichanthelium oligosanthes
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family YABBY
Protein Properties Length: 76aa    MW: 8498.59 Da    PI: 10.7567
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do011549.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY73.86e-233066134170
       YABBY 134 keeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                 +eeiqrik+snP+ishreafsaaaknWah+P++hfgl
  Do011549.1  30 REEIQRIKTSNPEISHREAFSAAAKNWAHLPRLHFGL 66 
                 7**********************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046906.3E-203066IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MFFQLQRKDS VSRQHTIDSS KLLLLPNINR EEIQRIKTSN PEISHREAFS AAAKNWAHLP  60
RLHFGLSVAD GGGGSS
Functional Description ? help Back to Top
Source Description
UniProtMay play a role in floral meristem development and maintenance of stamens, rather than in determining polarity in floral organs. {ECO:0000269|PubMed:15604733, ECO:0000269|PubMed:17369428}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapDo011549.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9631497e-56EU963149.1 Zea mays clone 258350 protein YABBY mRNA, complete cds.
GenBankEU9706587e-56EU970658.1 Zea mays clone 348580 protein YABBY mRNA, complete cds.
GenBankKJ7279907e-56KJ727990.1 Zea mays clone pUT6110 C2C2-YABBY transcription factor (YAB3) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955497.18e-27protein YABBY 1
RefseqXP_025802461.17e-27protein YABBY 1-like
SwissprotQ7XIM75e-23YAB1_ORYSJ; Protein YABBY 1
TrEMBLA0A1E5W7D61e-48A0A1E5W7D6_9POAL; Uncharacterized protein
STRINGPavir.Ba03779.1.p3e-26(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP139437121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.11e-18YABBY family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Ohmori Y,Abiko M,Horibata A,Hirano HY
    A transposon, Ping, is integrated into intron 4 of the DROOPING LEAF gene of rice, weakly reducing its expression and causing a mild drooping leaf phenotype.
    Plant Cell Physiol., 2008. 49(8): p. 1176-84
    [PMID:18593744]
  3. Ohmori Y,Toriba T,Nakamura H,Ichikawa H,Hirano HY
    Temporal and spatial regulation of DROOPING LEAF gene expression that promotes midrib formation in rice.
    Plant J., 2011. 65(1): p. 77-86
    [PMID:21175891]
  4. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]
  5. Tanaka W, et al.
    The YABBY gene TONGARI-BOUSHI1 is involved in lateral organ development and maintenance of meristem organization in the rice spikelet.
    Plant Cell, 2012. 24(1): p. 80-95
    [PMID:22286138]
  6. Yang C,Ma Y,Li J
    The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway.
    J. Exp. Bot., 2016. 67(18): p. 5545-5556
    [PMID:27578842]