![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Do015938.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 66aa MW: 7503.67 Da PI: 11.8898 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 59.8 | 1.1e-18 | 20 | 66 | 7 | 53 |
TCP 7 rhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlq 53
r ++hTkv+gR+R +R+ a+c ar+ L+ L +++d++t+ WLlq
Do015938.1 20 RYRDRHTKVEGRGRHIRMAAPCTARVARLTGDLRHKSDGETVRWLLQ 66
778*******************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 15.527 | 21 | 66 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 2.8E-14 | 22 | 66 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MPVEFLGSGL QLANPRPAPR YRDRHTKVEG RGRHIRMAAP CTARVARLTG DLRHKSDGET 60 VRWLLQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}. | |||||
| UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Do015938.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT034594 | 6e-53 | BT034594.1 Zea mays full-length cDNA clone ZM_BFb0002D09 mRNA, complete cds. | |||
| GenBank | KJ726827 | 6e-53 | KJ726827.1 Zea mays clone pUT3366 TCP transcription factor (TCP19) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004957394.1 | 7e-35 | transcription factor PCF2 | ||||
| Swissprot | A2YXQ1 | 8e-21 | PCF2_ORYSI; Transcription factor PCF2 | ||||
| Swissprot | Q6ZBH6 | 8e-21 | PCF2_ORYSJ; Transcription factor PCF2 | ||||
| TrEMBL | A0A1E5V8P1 | 5e-41 | A0A1E5V8P1_9POAL; Uncharacterized protein | ||||
| STRING | Si030591m | 2e-34 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3912 | 31 | 67 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51910.2 | 1e-19 | TCP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




