PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Do018449.1

Organism

Dichanthelium oligosanthes

Taxonomic ID

888268

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

ZF-HD

Protein Properties

Length: 86aa MW: 9200.18 Da PI: 7.3404

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do018449.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	99.1	3.3e-31	20	76	2	59
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 + v+Y+eC++NhAas+Gg+avDGC+Efm+s g+egtaaal CaAC+CHR+FHRreve Do018449.1 20 KVVHYRECQRNHAASIGGYAVDGCREFMAS-GAEGTAAALLCAACQCHRSFHRREVEA 76 5799***********************9.999*******************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	3.0E-16	19	85	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.4E-30	22	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.9E-26	23	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.749	24	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 86 aa Download sequence Send to blast
MGPQQDRSMA NGTASRKETK VVHYRECQRN HAASIGGYAV DGCREFMASG AEGTAAALLC 60 AACQCHRSFH RREVEADCDC SSTTSG

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do018449.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004978478.1	4e-53	mini zinc finger protein 1
Swissprot	B8BIU8	3e-33	MIF1_ORYSI; Mini zinc finger protein 1
Swissprot	Q2RB28	3e-33	MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBL	A0A1E5VWE8	2e-56	A0A1E5VWE8_9POAL; Mini zinc finger protein 1
STRING	Si027403m	1e-52	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-23	mini zinc finger 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]