![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Do020566.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 147aa MW: 16504.2 Da PI: 10.6477 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 149.9 | 1.3e-46 | 14 | 144 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96
lp+Gf F+Pt+eelv +yLk+k+ g ++ i++vd+ +ePwdLp k +++++ ew+fF++ d+ky+ g+r+nr t++gyWkatgkd+ + s+
Do020566.1 14 LPVGFCFRPTNEELVRHYLKPKIVGAAHPDLLLIPDVDLSACEPWDLPaKaLIRSNDPEWFFFAPLDRKYPGGHRSNRCTTAGYWKATGKDRLIRSRpA 112
799************************999888***************5345666778**************************************989 PP
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128
g+l+g+kktLvf++grap+g++t W+mheyr
Do020566.1 113 GTLIGVKKTLVFHRGRAPRGHRTAWIMHEYRT 144
999***************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 9.81E-51 | 13 | 145 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 50.276 | 14 | 147 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.3E-25 | 15 | 143 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 147 aa Download sequence Send to blast |
MPSPPPPPPP PGALPVGFCF RPTNEELVRH YLKPKIVGAA HPDLLLIPDV DLSACEPWDL 60 PAKALIRSND PEWFFFAPLD RKYPGGHRSN RCTTAGYWKA TGKDRLIRSR PAGTLIGVKK 120 TLVFHRGRAP RGHRTAWIMH EYRTAKP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
| 3swm_B | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
| 3swm_C | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
| 3swm_D | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
| 3swp_A | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
| 3swp_B | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
| 3swp_C | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
| 3swp_D | 3e-40 | 13 | 147 | 19 | 148 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Do020566.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT067635 | 1e-132 | BT067635.1 Zea mays full-length cDNA clone ZM_BFc0101L24 mRNA, complete cds. | |||
| GenBank | EU953263 | 1e-132 | EU953263.1 Zea mays clone 1394620 mRNA sequence. | |||
| GenBank | KJ726982 | 1e-132 | KJ726982.1 Zea mays clone pUT3683 NAC transcription factor (NAC117) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004964250.1 | 2e-84 | uncharacterized protein LOC101755267 isoform X1 | ||||
| Refseq | XP_004964251.1 | 2e-84 | uncharacterized protein LOC101755267 isoform X2 | ||||
| Refseq | XP_025813332.1 | 3e-84 | uncharacterized protein LOC112890695 | ||||
| Swissprot | F4JN35 | 1e-57 | NTL9_ARATH; Protein NTM1-like 9 | ||||
| TrEMBL | A0A1E5VDL5 | 1e-102 | A0A1E5VDL5_9POAL; Protein NTM1-like 9 | ||||
| STRING | Si006105m | 9e-84 | (Setaria italica) | ||||
| STRING | Sb10g000101.1 | 4e-84 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP13413 | 25 | 29 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G35580.3 | 2e-62 | NAC transcription factor-like 9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




