PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Do023208.1

Organism

Dichanthelium oligosanthes

Taxonomic ID

888268

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

bZIP

Protein Properties

Length: 148aa MW: 16192.2 Da PI: 9.0044

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do023208.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	43	9.7e-14	73	126	5	58
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 +r rk+kNR +A+rsR+R+ a++ eLe++v L aeN++L+k eelk+ +a+ Do023208.1 73 RRRERKMKNRDSAQRSRARRYAYVNELEKEVRLLRAENDELRKLCEELKEAAAE 126 7889*********************************************98875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	1.1E-7	69	133	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.312	71	122	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.9E-11	73	124	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.5E-12	73	125	No hit	No description
SuperFamily	SSF57959	6.06E-10	73	123	No hit	No description
PROSITE pattern	PS00036	0	77	91	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MEPQWGEAEQ LVLWGAGTGS NDAAGAATCL CPATVAAAAP GTCVFPRHAL EQEMLRRADV 60 QLQGGGGGGG GDRRRERKMK NRDSAQRSRA RRYAYVNELE KEVRLLRAEN DELRKLCEEL 120 KEAAAEAPAR AKRAPHHHQL QRTSSASF

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do023208.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004974151.1	3e-33	ABSCISIC ACID-INSENSITIVE 5-like protein 7
Swissprot	Q84JK2	5e-13	FD_ARATH; Protein FD
TrEMBL	A0A1E5WE87	1e-102	A0A1E5WE87_9POAL; Uncharacterized protein
STRING	Pavir.Fa00021.1.p	4e-34	(Panicum virgatum)
STRING	Si014546m	7e-34	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP15193	17	19

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]