![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Do024356.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 100aa MW: 11667.4 Da PI: 6.6244 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 34.4 | 5e-11 | 55 | 94 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+T +E++l+ + +++ G++ W++Ia +++ gRt++++ +w
Do024356.1 55 FTDDEEDLFFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWS 94
9******************.*********.*******99986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 6.8E-9 | 51 | 99 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.79E-9 | 54 | 96 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 5.5E-11 | 55 | 95 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.38E-9 | 55 | 93 | No hit | No description |
| PROSITE profile | PS50090 | 6.806 | 55 | 97 | IPR017877 | Myb-like domain |
| Pfam | PF00249 | 1.5E-9 | 55 | 94 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
MKKIAPHSIG DHRIGGCNIF LHGLVLCSFA YFPDQLYTFM IIAEANSTAH HFVDFTDDEE 60 DLFFRMHRLV GNRWELIAGR IPGRTAEEVE MFWSKKHQEK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Do024356.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU973098 | 4e-52 | EU973098.1 Zea mays clone 393226 hypothetical protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025816197.1 | 2e-30 | MYB-like transcription factor ETC3 | ||||
| Swissprot | B3H4X8 | 5e-17 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
| TrEMBL | A0A1E5V4A8 | 1e-69 | A0A1E5V4A8_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.J30777.1.p | 1e-34 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5275 | 31 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30424.1 | 2e-19 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




