![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Do025310.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 107aa MW: 11045.5 Da PI: 6.2356 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 67.7 | 2.1e-21 | 1 | 67 | 17 | 83 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvepl 83
m+ + P n+ki+ dake v+ec ++fi+ v a+ +r+kr ++gddll a+++lGf+dyv pl
Do025310.1 1 MRLATPPNSKITGDAKEAVDECLAKFITIVNRAAAAEYKRDKRTNVTGDDLLLAMGNLGFDDYVGPL 67
67889***********************************************************998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 5.5E-8 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 5.6E-16 | 1 | 67 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.18E-14 | 2 | 69 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MRLATPPNSK ITGDAKEAVD ECLAKFITIV NRAAAAEYKR DKRTNVTGDD LLLAMGNLGF 60 DDYVGPLIPA PLPRERGHAT HPSQHDVTGA GAGPCGPDIA AGPAVGA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-16 | 1 | 67 | 18 | 84 | NF-YB |
| 4awl_B | 3e-16 | 1 | 67 | 19 | 85 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 3e-16 | 1 | 67 | 19 | 85 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Do025310.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012700681.1 | 1e-27 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | O23310 | 2e-18 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | Q75IZ7 | 5e-18 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A1E5VZ68 | 2e-71 | A0A1E5VZ68_9POAL; Uncharacterized protein | ||||
| STRING | Si007865m | 1e-26 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP14056 | 13 | 26 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 1e-20 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




