PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Do027609.1

Organism

Dichanthelium oligosanthes

Taxonomic ID

888268

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

NF-YC

Protein Properties

Length: 79aa MW: 8753.53 Da PI: 4.017

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do027609.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	61.8	1.4e-19	7	61	45	99
NF-YC 45 vllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 l++ acelfi elt r+w + e krrt++k d++ av++td fdflvdiv + Do027609.1 7 WLYCSACELFITELTRRAWAXTLEGKRRTVHKEDVSVAVQNTDLFDFLVDIVMVE 61 68899**********************************************9865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	1.57E-14	3	58	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	6.1E-17	6	58	IPR009072	Histone-fold
Pfam	PF00808	7.3E-8	11	45	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MADENFWLYC SACELFITEL TRRAWAXTLE GKRRTVHKED VSVAVQNTDL FDFLVDIVMV 60 EAGGAGHAVA GDDDDGVLE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5g49_B	1e-15	8	58	43	93	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do027609.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU958236	4e-42	EU958236.1 Zea mays clone 1680099 nuclear transcription factor Y subunit C-9 mRNA, complete cds.
GenBank	HQ234502	4e-42	HQ234502.1 Zea mays clone BAC ZMMBBb0342E21 DNA-binding protein, peroxisomal-CoA synthetase, cleavage and polyadenylation specificity factor 5, DNA mismatch repair protein, and putative potassium efflux system protein family genes, complete cds; and unknown gene.
GenBank	KJ727009	4e-42	KJ727009.1 Zea mays clone pUT3990 CCAAT-HAP5 transcription factor (CA5P1) gene, partial cds.
GenBank	KJ727010	4e-42	KJ727010.1 Zea mays clone pUT3991 CCAAT-HAP5 transcription factor (CA5P2) gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025825631.1	9e-26	nuclear transcription factor Y subunit C-2-like
Swissprot	Q9ZVL3	3e-15	NFYC3_ARATH; Nuclear transcription factor Y subunit C-3
TrEMBL	A0A1E5UNM2	2e-49	A0A1E5UNM2_9POAL; Uncharacterized protein
STRING	LPERR04G25540.1	1e-25	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP11658	33	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G56170.2	1e-16	nuclear factor Y, subunit C2

Publications ? help Back to Top
Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Liu X, et al. The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis. Nat Commun, 2016. 7: p. 12768 [PMID:27624486] Myers ZA, et al. NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana. PLoS Genet., 2016. 12(9): p. e1006333 [PMID:27685091] Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants. Mol Plant, 2017. 10(4): p. 645-648 [PMID:27871811] Tang Y, et al. Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation. Mol Plant, 2017. 10(2): p. 260-273 [PMID:27876642] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]