![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Do029007.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 136aa MW: 14961 Da PI: 10.3366 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 103.6 | 1.1e-32 | 39 | 96 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+Dgy+WrKYGqK vk+s+fprsYYrCtsa C vkk+ver++++p vv++tYeg+H h+
Do029007.1 39 EDGYRWRKYGQKAVKNSPFPRSYYRCTSAACGVKKRVERDRDEPGVVVTTYEGKHAHP 96
8********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.1E-33 | 24 | 98 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.75E-28 | 30 | 98 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 31.204 | 33 | 98 | IPR003657 | WRKY domain |
| SMART | SM00774 | 9.4E-37 | 38 | 97 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.0E-26 | 39 | 96 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MTTMAATAAH AAKPKKKKHR EPRELRFTFR TQSQVDQLED GYRWRKYGQK AVKNSPFPRS 60 YYRCTSAACG VKKRVERDRD EPGVVVTTYE GKHAHPCPAP ATGHLPPPLL LADGGRVARG 120 DAAAGCAQER AVDTSA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 5e-29 | 29 | 99 | 8 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 5e-29 | 29 | 99 | 8 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Do029007.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP098810 | 3e-87 | FP098810.1 Phyllostachys edulis cDNA clone: bphyst005o12, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002279385.1 | 2e-43 | PREDICTED: probable WRKY transcription factor 48 | ||||
| Swissprot | Q9FGZ4 | 6e-39 | WRK48_ARATH; Probable WRKY transcription factor 48 | ||||
| TrEMBL | A0A1E5WN93 | 1e-95 | A0A1E5WN93_9POAL; Putative WRKY transcription factor 48 | ||||
| STRING | VIT_05s0077g00730.t01 | 6e-43 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2125 | 37 | 96 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49520.1 | 2e-39 | WRKY DNA-binding protein 48 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




