![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Dusal.0433s00010.1.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Dunaliellaceae; Dunaliella
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 154aa MW: 16569.7 Da PI: 6.2635 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 169 | 5.7e-53 | 10 | 104 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
+eqdr+lPian+srimkk+lP+naki+kdake++q+cvsefisf+tseasdkc rekrktingddllwa++tlGfe y+epl++yl+k+
Dusal.0433s00010.1.p 10 HEQDRYLPIANISRIMKKTLPGNAKIAKDAKEITQDCVSEFISFITSEASDKCLREKRKTINGDDLLWAMSTLGFESYMEPLRLYLQKF 98
69*************************************************************************************** PP
NF-YB 91 relege 96
r++e+e
Dusal.0433s00010.1.p 99 RHAEAE 104
**9987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.8E-51 | 9 | 115 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.43E-38 | 12 | 115 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.8E-26 | 15 | 79 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.8E-20 | 43 | 61 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 46 | 62 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.8E-20 | 62 | 80 | No hit | No description |
| PRINTS | PR00615 | 1.8E-20 | 81 | 99 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 154 aa Download sequence Send to blast |
MAESGGGASH EQDRYLPIAN ISRIMKKTLP GNAKIAKDAK EITQDCVSEF ISFITSEASD 60 KCLREKRKTI NGDDLLWAMS TLGFESYMEP LRLYLQKFRH AEAEASNKGD PKKDAAHPSF 120 LQANPQGMVP AGFMPQSGAT SASAGLEEPS SSS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 2e-46 | 10 | 99 | 3 | 92 | NF-YB |
| 4awl_B | 2e-46 | 10 | 99 | 4 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-46 | 10 | 99 | 4 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP869114 | 1e-157 | KP869114.1 Dunaliella salina nuclear factor Y B subunit (NF-YB) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020182576.1 | 5e-57 | nuclear transcription factor Y subunit B-2-like | ||||
| Refseq | XP_020182577.1 | 5e-57 | nuclear transcription factor Y subunit B-2-like | ||||
| Swissprot | P25209 | 7e-55 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
| TrEMBL | A0A0K2GUN6 | 1e-102 | A0A0K2GUN6_DUNSA; Nuclear factor Y B subunit | ||||
| STRING | XP_002949581.1 | 3e-56 | (Volvox carteri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP2023 | 16 | 16 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 5e-57 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Dusal.0433s00010.1.p |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




