![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT03743 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 115aa MW: 13127 Da PI: 10.2225 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 56.4 | 7.1e-18 | 23 | 70 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT eEd ll+++++ G g+W++ ar+ g++Rt+k+c++rw++yl
EMT03743 23 RGPWTVEEDVLLANYIAANGEGRWNALARRAGLKRTGKSCRLRWLNYL 70
89*********************************************7 PP
| |||||||
| 2 | Myb_DNA-binding | 45 | 2.4e-14 | 76 | 115 | 1 | 42 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcks 42
rg +T+eE++l +++++++G++ W++Ia++++ gRt++++k+
EMT03743 76 RGGMTAEEQLLVLELHARWGNR-WSKIAQHLP-GRTDNEIKN 115
6789******************.*********.*******97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.98 | 18 | 74 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.4E-14 | 22 | 72 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.68E-28 | 22 | 115 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.3E-16 | 23 | 70 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.0E-21 | 24 | 77 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.75E-10 | 25 | 70 | No hit | No description |
| SMART | SM00717 | 4.1E-5 | 75 | 115 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 16.766 | 75 | 115 | IPR017930 | Myb domain |
| Pfam | PF00249 | 5.6E-13 | 76 | 115 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.9E-19 | 78 | 115 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.03E-8 | 79 | 115 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MACDQRGMRG EAAAAGEEEM LRRGPWTVEE DVLLANYIAA NGEGRWNALA RRAGLKRTGK 60 SCRLRWLNYL RPDLRRGGMT AEEQLLVLEL HARWGNRWSK IAQHLPGRTD NEIKN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1mse_C | 4e-24 | 20 | 115 | 1 | 95 | C-Myb DNA-Binding Domain |
| 1msf_C | 4e-24 | 20 | 115 | 1 | 95 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK368690 | 1e-148 | AK368690.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2078D05. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020189377.1 | 2e-76 | protein ODORANT1-like | ||||
| Swissprot | Q10MB4 | 3e-58 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
| TrEMBL | M8BAJ8 | 8e-77 | M8BAJ8_AEGTA; Transcription factor MYB21 | ||||
| STRING | EMT03743 | 1e-77 | (Aegilops tauschii) | ||||
| STRING | Traes_2DS_61B920833.1 | 6e-76 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP198 | 38 | 330 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27810.1 | 4e-53 | myb domain protein 21 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




