![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT05173 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 145aa MW: 16244.7 Da PI: 9.8489 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.7 | 1.1e-17 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd+ lv +++++G+g+W++++ g+ R+ k+c++rw +yl
EMT05173 14 KGPWTPEEDLMLVSYIQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
79********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 53.2 | 7e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T +E++l+v++ ++lG++ W++Ia++++ Rt++++k++w+++l
EMT05173 67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
89********************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 1.2E-24 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 17.83 | 9 | 61 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 6.5E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.3E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.81E-11 | 16 | 61 | No hit | No description |
| PROSITE profile | PS51294 | 24.722 | 62 | 116 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.7E-25 | 65 | 117 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 4.3E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.4E-15 | 67 | 112 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.16E-11 | 69 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009414 | Biological Process | response to water deprivation | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009723 | Biological Process | response to ethylene | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0010468 | Biological Process | regulation of gene expression | ||||
| GO:0046686 | Biological Process | response to cadmium ion | ||||
| GO:0080167 | Biological Process | response to karrikin | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 145 aa Download sequence Send to blast |
MGRPPCCDKV GVKKGPWTPE EDLMLVSYIQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY 60 LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ 120 DAGGNDGGSE GAGAGGGIKK EMYIL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 2e-27 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
| 1mse_C | 2e-27 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
| 1msf_C | 2e-27 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to DNA consensus sequences found in the promoters of genes encoding very-long-chain fatty acid-condensing enzymes involved in cuticular wax biosynthesis (PubMed:21398568). Functions together with MYB94 in the activation of cuticular wax biosynthesis (PubMed:27577115). Involved in drought stress response through abscisic acid (ABA) signaling. Mediates ABA signals that enhance plant resistance to drought by reducing stomatal opening. Mediates ABA-auxin cross-talk to regulate lateral root growth under drought stress conditions (PubMed:19625633). Involved in the regulation of ABA biosynthesis and ABA-dependent seed dormancy state. Binds to the promoters of NCED2 and NCED6, which are enzymes catalyzing the first step of ABA biosynthesis (PubMed:25616734). Regulates seed germination by controlling the expression of ABI4, a repressor of lipid breakdown during seed germination (PubMed:25869652). Binds to the promoter of LTP3 and transactivates LTP3 gene in response to drought stress and freezing (PubMed:23404903). Involved in cold stress response. Binds directly to the promoters of heptahelical protein (HHP) genes in response to cold stress. HHPs modulate the expression of SCRM/ICE1, SCRM2/ICE2 and CAMTA3, which are upstream regulators of cold-responsive C-repeat-binding factors (CBFs) (PubMed:25912720). Involved in defense responses against the bacterial pathogen Pseudomonas syringae. May act as a molecular link that mediates cross-talks between ABA and salicylate (PubMed:20149112). Involved in a crosstalk between the circadian clock and ABA signaling. Binds directly to the promoter of APRR1/TOC1 to activate its expression (PubMed:26725725). {ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:20149112, ECO:0000269|PubMed:21398568, ECO:0000269|PubMed:23404903, ECO:0000269|PubMed:25616734, ECO:0000269|PubMed:25869652, ECO:0000269|PubMed:25912720, ECO:0000269|PubMed:26725725, ECO:0000269|PubMed:27577115}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00579 | DAP | Transfer from AT5G62470 | Download |
| |||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA) (PubMed:19625633). Induced by infection with the cauliflower mosaic virus (CaMV) (PubMed:10226370). Induced by cold stress (PubMed:25912720). {ECO:0000269|PubMed:10226370, ECO:0000269|PubMed:19625633, ECO:0000269|PubMed:25912720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF951914 | 0.0 | JF951914.1 Aegilops tauschii clone TaMYB31 R2R3-MYB protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020146652.1 | 6e-99 | myb-related protein 306-like | ||||
| Swissprot | Q24JK1 | 3e-82 | MYB96_ARATH; Transcription factor MYB96 | ||||
| TrEMBL | M8BEK9 | 1e-104 | M8BEK9_AEGTA; Myb-related protein 306 | ||||
| STRING | EMT05173 | 1e-104 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP229 | 38 | 296 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G47600.1 | 5e-84 | myb domain protein 94 | ||||




