PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT05224

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

HSF

Protein Properties

Length: 102aa MW: 11126.6 Da PI: 4.9776

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT05224	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	81.4	1.3e-25	40	99	2	61
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl+k+y++++d+ +++++sw e+ +fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y+ EMT05224 40 FLTKTYQLVDDPCTDHIVSWGEDDATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYN 99 9**********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	4.5E-27	34	99	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	4.4E-21	36	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	5.3E-23	39	99	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	1.9E-21	40	99	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.6E-16	40	63	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.6E-16	78	90	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.6E-16	91	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0008356	Biological Process	asymmetric cell division
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MAFLVERCGE MVVSMEMGSG AAGAHGAGGG VAGKPVPAPF LTKTYQLVDD PCTDHIVSWG 60 EDDATFVVWR PPEFARDLLP NYFKHNNFSS FVRQLNTYNV TS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	1e-16	28	98	17	87	Heat shock factor protein 1
5d5v_B	1e-16	28	98	17	87	Heat shock factor protein 1
5d5v_D	1e-16	28	98	17	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269\|PubMed:16202242}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF208550	1e-163	KF208550.1 Triticum aestivum heat shock factor B4a (HsfB4a) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020186930.1	5e-68	heat stress transcription factor B-4b-like
Swissprot	Q7XHZ0	9e-55	HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBL	M8AUY0	3e-71	M8AUY0_AEGTA; Heat stress transcription factor B-4b
STRING	EMT05224	5e-72	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP121	37	394

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G46264.1	7e-41	heat shock transcription factor B4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]