![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT05876 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 83aa MW: 9195.79 Da PI: 9.0129 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 86.7 | 1.3e-27 | 3 | 52 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+ rqvtfskRr g+lKKA+EL vLCdaeva+i+fs++g+lyey+s
EMT05876 3 RIEDAPSRQVTFSKRRSGLLKKAFELGVLCDAEVALIVFSPRGRLYEYAS 52
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd00265 | 1.33E-32 | 1 | 52 | No hit | No description |
| PROSITE profile | PS50066 | 26.997 | 1 | 54 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.4E-26 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.75E-24 | 1 | 55 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.5E-25 | 3 | 50 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.8E-18 | 16 | 31 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.8E-18 | 31 | 52 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MRRIEDAPSR QVTFSKRRSG LLKKAFELGV LCDAEVALIV FSPRGRLYEY ASAPDSSFFQ 60 TCPPLRIVCL LEKSLALAST AVC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 4e-17 | 3 | 54 | 9 | 60 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 4e-17 | 3 | 54 | 9 | 60 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 4e-17 | 3 | 54 | 9 | 60 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 4e-17 | 3 | 54 | 9 | 60 | Myocyte-specific enhancer factor 2A |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM502883 | 2e-84 | AM502883.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM18 (WM18 gene). | |||
| GenBank | DQ512335 | 2e-84 | DQ512335.1 Triticum aestivum MADS-box transcription factor TaAGL18 (AGL18) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020153307.1 | 9e-31 | MADS-box protein SOC1-like | ||||
| Swissprot | P0C5B2 | 2e-26 | MAD56_ORYSJ; MADS-box transcription factor 56 | ||||
| TrEMBL | M8AMY5 | 3e-52 | M8AMY5_AEGTA; MADS-box transcription factor 56 | ||||
| STRING | EMT05876 | 6e-53 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11880.1 | 1e-27 | AGAMOUS-like 14 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




