PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT06950

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

NAC

Protein Properties

Length: 105aa MW: 12700 Da PI: 8.8173

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT06950	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	48	4e-15	45	105	1	62
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFs 62 lppGf FhPt+ e++ +yL +kv++k +++ ++++e d+ k++ w+Lp++v+ +eke yfFs EMT06950 45 LPPGFGFHPTNMEIIIFYLVPKVQKKAFDT-TMVREEDMKKYDLWNLPNEVNMGEKERYFFS 105 79************************99.88***********99999******6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.02E-16	41	105	IPR003441	NAC domain
PROSITE profile	PS51005	18.372	45	105	IPR003441	NAC domain
Pfam	PF02365	1.8E-5	46	105	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
MEIIIFYLVP KVLKKAFDTT MVREVDMKKY ELWNLPNEKK QQLNLPPGFG FHPTNMEIII 60 FYLVPKVQKK AFDTTMVREE DMKKYDLWNL PNEVNMGEKE RYFFS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-13	42	105	14	77	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-13	42	105	14	77	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-13	42	105	14	77	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-13	42	105	14	77	NO APICAL MERISTEM PROTEIN
3swm_A	9e-14	42	105	17	80	NAC domain-containing protein 19
3swm_B	9e-14	42	105	17	80	NAC domain-containing protein 19
3swm_C	9e-14	42	105	17	80	NAC domain-containing protein 19
3swm_D	9e-14	42	105	17	80	NAC domain-containing protein 19
3swp_A	9e-14	42	105	17	80	NAC domain-containing protein 19
3swp_B	9e-14	42	105	17	80	NAC domain-containing protein 19
3swp_C	9e-14	42	105	17	80	NAC domain-containing protein 19
3swp_D	9e-14	42	105	17	80	NAC domain-containing protein 19
4dul_A	1e-13	42	105	14	77	NAC domain-containing protein 19
4dul_B	1e-13	42	105	14	77	NAC domain-containing protein 19
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK375762	3e-56	AK375762.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3103J16.
GenBank	FR819761	3e-56	FR819761.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC009 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020181832.1	4e-20	NAC domain-containing protein 92-like
TrEMBL	M8AZ17	1e-70	M8AZ17_AEGTA; NAC domain-containing protein 77
STRING	EMT06950	2e-71	(Aegilops tauschii)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39610.1	4e-17	NAC domain containing protein 6