![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT08953 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 101aa MW: 10966.4 Da PI: 10.7448 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 37.1 | 6.9e-12 | 21 | 71 | 12 | 62 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 12 kNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
+NR++A+ R+RKka++ eLe k+k Le N +L +++++l++e +l++
EMT08953 21 RNRVSAQQARERKKAYMTELEVKAKDLELRNAELEQKVSTLQNENNTLRQI 71
9*********************************************99986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 6.5E-9 | 13 | 74 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 2.2E-10 | 20 | 72 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 3.63E-12 | 20 | 72 | No hit | No description |
| CDD | cd14704 | 4.29E-16 | 21 | 65 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 5.5E-16 | 21 | 74 | No hit | No description |
| PROSITE profile | PS50217 | 10.691 | 21 | 75 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MVEWADGGAA KPTVVVGLSS RNRVSAQQAR ERKKAYMTEL EVKAKDLELR NAELEQKVST 60 LQNENNTLRQ ILKNTTAHAG KKSSGGKGGD GGKKHHHFGK G |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK365648 | 3e-96 | AK365648.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2035O05. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020188760.1 | 8e-52 | transcription factor HY5-like | ||||
| Swissprot | Q9SM50 | 1e-22 | HY5_SOLLC; Transcription factor HY5 | ||||
| TrEMBL | M8C179 | 7e-67 | M8C179_AEGTA; Transcription factor HY5 | ||||
| STRING | EMT08953 | 1e-67 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1408 | 38 | 111 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G11260.1 | 7e-24 | bZIP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




