![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT12202 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 182aa MW: 19830.1 Da PI: 6.5078 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 97.8 | 7.7e-31 | 1 | 52 | 4 | 55 |
G2-like 4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
EMT12202 1 MRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 52
79*************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 3.05E-14 | 1 | 53 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 9.082 | 1 | 55 | IPR017930 | Myb domain |
| TIGRFAMs | TIGR01557 | 6.2E-23 | 1 | 53 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 8.9E-27 | 1 | 52 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 2.4E-7 | 1 | 51 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009887 | Biological Process | organ morphogenesis | ||||
| GO:0009944 | Biological Process | polarity specification of adaxial/abaxial axis | ||||
| GO:0009956 | Biological Process | radial pattern formation | ||||
| GO:0010051 | Biological Process | xylem and phloem pattern formation | ||||
| GO:0048481 | Biological Process | plant ovule development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 182 aa Download sequence Send to blast |
MRWTTSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTIKTTDHKP 60 AAASSYGQAK TIIDIPDDSS FDIANTSGSE SSVQQSNLDG NEHGSNMCAL WSNNSSRGAW 120 SFHGKSRSDA NPGDIKSFED VQSQCPNVVA DDAADLMSAP FRLSELVVGA KKPNLDFTLG 180 RM |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 7e-18 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 7e-18 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 7e-18 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 7e-18 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 7e-18 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 7e-18 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 7e-18 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 7e-18 | 1 | 54 | 5 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00174 | DAP | Transfer from AT1G32240 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | - | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT036911 | 9e-73 | BT036911.1 Zea mays full-length cDNA clone ZM_BFb0147F05 mRNA, complete cds. | |||
| GenBank | KJ726829 | 9e-73 | KJ726829.1 Zea mays clone pUT3369 G2-like transcription factor (GLK47) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020156179.1 | 1e-132 | probable transcription factor KAN2 isoform X1 | ||||
| Swissprot | Q9C616 | 5e-36 | KAN2_ARATH; Probable transcription factor KAN2 | ||||
| TrEMBL | A0A3B6QJP8 | 1e-131 | A0A3B6QJP8_WHEAT; Uncharacterized protein | ||||
| TrEMBL | M8B627 | 1e-133 | M8B627_AEGTA; Putative Myb family transcription factor | ||||
| STRING | EMT12202 | 1e-134 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP9438 | 34 | 45 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G17695.1 | 5e-37 | G2-like family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




