PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT14086

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

HSF

Protein Properties

Length: 86aa MW: 9505.57 Da PI: 4.9085

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT14086	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	79.2	6.8e-25	17	76	5	64
HHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS HSF_DNA-bind 5 klyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64 +y++++d++++ ++sw +nsf+v+++ efa+++LpkyFkh+nf+SFvRQLn+Y+ ++ EMT14086 17 TTYDMVDDPATDAVVSWGPANNSFIVWNTPEFARDLLPKYFKHNNFSSFVRQLNTYERHR 76 68**************999*********************************9775 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00415	5.3E-19	10	83	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.1E-14	14	37	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Gene3D	G3DSA:1.10.10.10	1.8E-25	15	75	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	6.4E-21	17	76	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	1.06E-22	18	79	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	3.1E-14	52	64	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.1E-14	65	77	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 86 aa Download sequence Send to blast
MDGGVAAAAA AAAAASTTYD MVDDPATDAV VSWGPANNSF IVWNTPEFAR DLLPKYFKHN 60 NFSSFVRQLN TYERHRPFDP ECHMLP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	2e-19	4	72	19	87	Heat shock factor protein 1
5d5v_B	2e-19	4	72	19	87	Heat shock factor protein 1
5d5v_D	2e-19	4	72	19	87	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Not induced by heat stress. {ECO:0000269\|PubMed:18064488}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF208542	1e-85	KF208542.1 Triticum aestivum heat shock factor A1b (HsfA1b) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010943416.1	6e-33	heat stress transcription factor A-1 isoform X1
Refseq	XP_020528994.1	5e-33	heat stress transcription factor A-1 isoform X2
Swissprot	Q84T61	3e-31	HSFA1_ORYSJ; Heat stress transcription factor A-1
TrEMBL	N1QV69	1e-57	N1QV69_AEGTA; Uncharacterized protein
STRING	EMT14086	2e-58	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP121	37	394

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G17750.1	1e-31	heat shock factor 1

Publications ? help Back to Top
Chauhan H,Khurana N,Agarwal P,Khurana P Heat shock factors in rice (Oryza sativa L.): genome-wide expression analysis during reproductive development and abiotic stress. Mol. Genet. Genomics, 2011. 286(2): p. 171-87 [PMID:21792744]