PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT14108

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

Dof

Protein Properties

Length: 117aa MW: 12724.3 Da PI: 10.0259

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT14108	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	97.7	8.2e-31	56	103	2	49
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnv 49 ++++l+cprC st+tkfCyynnys++qPr++C++CrryWt+GG+lrnv EMT14108 56 QQAKLECPRCSSTDTKFCYYNNYSTTQPRHYCRTCRRYWTHGGTLRNV 103 67899******************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	1.0E-18	56	103	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	5.0E-28	58	103	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	23.869	60	114	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	62	98	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MAPASASLLP AASSNAGTKR PFAAEASDAT ELPLALPQVQ ESAAGKKNGN GQSPQQQAKL 60 ECPRCSSTDT KFCYYNNYST TQPRHYCRTC RRYWTHGGTL RNVRNVNLSK GIVMRAT

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ687390	1e-137	FJ687390.1 Triticum aestivum Dof transcription factor 4 (Dof4) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020149474.1	4e-70	dof zinc finger protein DOF5.8-like
Swissprot	O24463	2e-23	PBF_MAIZE; Dof zinc finger protein PBF
TrEMBL	N1R2U0	8e-82	N1R2U0_AEGTA; Dof zinc finger protein PBF
STRING	EMT14108	1e-82	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP140	37	367

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G66940.1	8e-26	Dof family protein

Publications ? help Back to Top
Lang Z, et al. Defining the Role of prolamin-box binding factor1 Gene During Maize Domestication. J. Hered., 2014 Jul-Aug. 105(4): p. 576-582 [PMID:24683184] Zhang Z,Zheng X,Yang J,Messing J,Wu Y Maize endosperm-specific transcription factors O2 and PBF network the regulation of protein and starch synthesis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(39): p. 10842-7 [PMID:27621432]