![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT14466 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 90aa MW: 10328.8 Da PI: 10.2395 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 57.3 | 3.7e-18 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEde+l++ + ++G g+W++++r g++R++k+c++rw++yl
EMT14466 16 KGLWSPEEDEKLYNHIIRHGVGCWSSVPRLAGLHRCGKSCRLRWLNYL 63
678********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.209 | 11 | 67 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-21 | 14 | 62 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.8E-14 | 15 | 65 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.1E-16 | 16 | 63 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 4.49E-21 | 18 | 89 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.93E-12 | 19 | 63 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.5E-7 | 63 | 89 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50090 | 4.077 | 64 | 90 | IPR017877 | Myb-like domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MERPSSGGLG QPKLRKGLWS PEEDEKLYNH IIRHGVGCWS SVPRLAGLHR CGKSCRLRWL 60 NYLRPNLRRG SFSQQEEDHI IALHQILGNS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 7e-14 | 10 | 89 | 1 | 79 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Possible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB252145 | 1e-113 | AB252145.1 Triticum aestivum Tamyb2 mRNA for myb-related protein, complete cds. | |||
| GenBank | KM066946 | 1e-113 | KM066946.1 Triticum aestivum R2R3-MYB transcription factor (MYB86) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020158685.1 | 2e-59 | myb-related protein Hv33-like | ||||
| Swissprot | P20027 | 2e-53 | MYB3_HORVU; Myb-related protein Hv33 | ||||
| TrEMBL | A0A3B6A1L2 | 5e-58 | A0A3B6A1L2_WHEAT; Uncharacterized protein | ||||
| TrEMBL | A0A452ZQQ5 | 5e-58 | A0A452ZQQ5_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A452ZQS7 | 5e-58 | A0A452ZQS7_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A452ZQS9 | 4e-58 | A0A452ZQS9_AEGTS; Uncharacterized protein | ||||
| TrEMBL | A0A452ZQV0 | 7e-58 | A0A452ZQV0_AEGTS; Uncharacterized protein | ||||
| TrEMBL | N1QZ78 | 4e-59 | N1QZ78_AEGTA; Myb-related protein Hv33 | ||||
| STRING | EMT14466 | 7e-60 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3092 | 33 | 85 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26660.1 | 7e-41 | myb domain protein 86 | ||||




