![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT15029 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 91aa MW: 9709.01 Da PI: 9.8635 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 71.2 | 2e-22 | 14 | 71 | 3 | 60 |
HHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 3 lkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
+ k+y+++ed+ ++ +i w + +nsfvv d+ f++++Lp +Fkh+nf+SFvRQLn+Y
EMT15029 14 VWKTYRMVEDPGTDGVIGWGKGNNSFVVADPFVFSQTMLPAHFKHNNFSSFVRQLNTY 71
569******************************************************* PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00415 | 9.6E-15 | 9 | 88 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.5E-12 | 13 | 36 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene3D | G3DSA:1.10.10.10 | 2.8E-24 | 14 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 3.67E-21 | 14 | 72 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 6.9E-18 | 16 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.5E-12 | 51 | 63 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.5E-12 | 64 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MAAASVGGGG APGVWKTYRM VEDPGTDGVI GWGKGNNSFV VADPFVFSQT MLPAHFKHNN 60 FSSFVRQLNT YVSQLIPTRS VGSVVNSFSI I |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5w_B | 1e-16 | 14 | 71 | 5 | 62 | Putative transcription factor |
| 5d5x_B | 1e-16 | 14 | 71 | 5 | 62 | Putative transcription factor |
| 5d5x_E | 1e-16 | 14 | 71 | 5 | 62 | Putative transcription factor |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF234653 | 1e-104 | KF234653.1 Triticum aestivum heat shock factor C2a (HsfC2a) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015641665.1 | 1e-37 | heat stress transcription factor C-2b | ||||
| Swissprot | Q0DBL6 | 1e-38 | HFC2B_ORYSJ; Heat stress transcription factor C-2b | ||||
| TrEMBL | R7WAD2 | 1e-59 | R7WAD2_AEGTA; Uncharacterized protein | ||||
| STRING | EMT15029 | 2e-60 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4471 | 34 | 70 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24520.1 | 6e-24 | heat shock transcription factor C1 | ||||




