PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT15300

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

HB-other

Protein Properties

Length: 54aa MW: 6593.65 Da PI: 10.1163

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT15300	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	60	3.9e-19	3	53	7	57
--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS Homeobox 7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 ++++q+++Le+ F+ + yp++ +r++L ++lg++ +q+k+WF+NrRa++++ EMT15300 3 ISDNQIQILERTFKVCLYPDEIQRADLGRELGVQPQQIKFWFKNRRAQMRR 53 6899*********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	15.694	1	54	IPR001356	Homeobox domain
Pfam	PF00046	1.2E-16	3	53	IPR001356	Homeobox domain
CDD	cd00086	1.48E-12	3	53	No hit	No description
SMART	SM00389	1.8E-5	3	54	IPR001356	Homeobox domain
SuperFamily	SSF46689	1.23E-16	3	53	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	9.9E-18	4	53	IPR009057	Homeodomain-like
PRINTS	PR00031	4.2E-5	25	34	IPR000047	Helix-turn-helix motif
PRINTS	PR00031	4.2E-5	34	50	IPR000047	Helix-turn-helix motif

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 54 aa Download sequence Send to blast
MDISDNQIQI LERTFKVCLY PDEIQRADLG RELGVQPQQI KFWFKNRRAQ MRRI

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015967008.1	2e-15	homeobox-leucine zipper protein HDG11
Refseq	XP_020980110.1	2e-15	homeobox-leucine zipper protein HDG11-like isoform X1
Refseq	XP_020980112.1	2e-15	homeobox-leucine zipper protein HDG11-like isoform X2
Refseq	XP_020980113.1	2e-15	homeobox-leucine zipper protein HDG11-like isoform X2
Refseq	XP_020980114.1	2e-15	homeobox-leucine zipper protein HDG11-like isoform X2
Refseq	XP_025655491.1	2e-15	homeobox-leucine zipper protein HDG11
Refseq	XP_025701434.1	2e-15	homeobox-leucine zipper protein HDG11
Refseq	XP_029149194.1	2e-15	homeobox-leucine zipper protein HDG11
Refseq	XP_029149195.1	2e-15	homeobox-leucine zipper protein HDG11
Refseq	XP_029154366.1	2e-15	homeobox-leucine zipper protein HDG11
Refseq	XP_029154367.1	2e-15	homeobox-leucine zipper protein HDG11
Refseq	XP_029154368.1	2e-15	homeobox-leucine zipper protein HDG11
Swissprot	Q69T58	4e-16	ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBL	R7W947	1e-31	R7W947_AEGTA; Homeobox-leucine zipper protein ROC8
STRING	EMT15300	2e-32	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP37023	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G73360.1	2e-17	homeodomain GLABROUS 11