PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EMT18104

Organism

Aegilops tauschii

Taxonomic ID

37682

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops

Family

MYB

Protein Properties

Length: 114aa MW: 12991 Da PI: 10.158

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EMT18104	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.9	8.3e-17	15	61	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g+WT eEd +l+++++q+G g+W++ ++ g+ R++k+c++rw++yl EMT18104 15 GKWTMEEDGILANYIAQHGEGSWRSLPKNAGLLRCGKSCRLRWLNYL 61 89***************************99***********7 PP
2	Myb_DNA-binding	21.6	5.3e-07	67	93	1	26
TSSS-HHHHHHHHHHHHHTTTT.-HHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWkt 26 rg++++eEd+l+v++++ +G++ +++t EMT18104 67 RGNFSKEEDDLIVKLHAIHGNRyQFTT 93 89*******************966665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.1E-22	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.984	9	65	IPR017930	Myb domain
SMART	SM00717	7.8E-9	13	63	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.72E-22	15	90	IPR009057	Homeodomain-like
Pfam	PF00249	3.3E-15	15	61	IPR001005	SANT/Myb domain
CDD	cd00167	5.26E-9	16	61	No hit	No description
PROSITE profile	PS50090	4.112	62	90	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	5.3E-9	65	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 114 aa Download sequence Send to blast
MGRAPCCQKL GLKQGKWTME EDGILANYIA QHGEGSWRSL PKNAGLLRCG KSCRLRWLNY 60 LRDGLRRGNF SKEEDDLIVK LHAIHGNRYQ FTTVLVIGFS CQFAIHRRGN KGDN

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020157341.1	6e-59	myb-related protein P-like
Swissprot	P27898	9e-47	MYBP_MAIZE; Myb-related protein P
TrEMBL	R7WEN8	2e-79	R7WEN8_AEGTA; Myb-related protein P
STRING	EMT18104	3e-80	(Aegilops tauschii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47460.1	2e-44	myb domain protein 12

Publications ? help Back to Top
Robbins ML,Sekhon RS,Meeley R,Chopra S A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] Sidorenko L,Chandler V RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] Robbins ML,Wang P,Sekhon RS,Chopra S Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] Rhee Y,Sekhon RS,Chopra S,Kaeppler S Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] Morohashi K, et al. A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204]