![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT18616 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 123aa MW: 13341.5 Da PI: 8.7775 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 64.6 | 2.1e-20 | 58 | 105 | 2 | 49 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49
C vegC+adls++++y+ rhkvCe+hsk+p ++v+g+ rfCqqCsr
EMT18616 58 CAVEGCKADLSKCRHYYMRHKVCEAHSKMPLAIVAGRAMRFCQQCSRN 105
**********************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.1E-21 | 51 | 104 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 15.768 | 55 | 123 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 5.1E-19 | 56 | 106 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 8.4E-15 | 58 | 104 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 123 aa Download sequence Send to blast |
MPGSWDLAEL EHYAVPARPT PALAPPAWST AAAVVPSPSP LKRPRLVSSG RAGHCPSCAV 60 EGCKADLSKC RHYYMRHKVC EAHSKMPLAI VAGRAMRFCQ QCSRNKCEHQ DLNLDGLGIP 120 QPV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj0_A | 1e-13 | 58 | 104 | 6 | 52 | squamosa promoter-binding protein-like 12 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP094913 | 2e-45 | FP094913.1 Phyllostachys edulis cDNA clone: bphyem212i14, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020197530.1 | 5e-41 | squamosa promoter-binding-like protein 18 | ||||
| Swissprot | Q0J0K1 | 3e-25 | SPL18_ORYSJ; Squamosa promoter-binding-like protein 18 | ||||
| TrEMBL | N1R030 | 5e-85 | N1R030_AEGTA; Squamosa promoter-binding-like protein 18 | ||||
| STRING | EMT18616 | 8e-86 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1755 | 37 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G02065.2 | 5e-17 | squamosa promoter binding protein-like 8 | ||||




