![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | EMT23227 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
|
||||||||
| Family | HB-other | ||||||||
| Protein Properties | Length: 80aa MW: 8884.07 Da PI: 7.4192 | ||||||||
| Description | HB-other family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 50.9 | 2.6e-16 | 11 | 55 | 12 | 56 |
HHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 12 leeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
+ +Le++F+++++p++++ + L++++g+t +q+k+WFq rRa+ k
EMT23227 11 ILALEAAFKQCPHPDETQVANLSRETGMTPQQIKYWFQTRRAQIK 55
789***************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 1.3E-9 | 5 | 61 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 1.97E-14 | 9 | 57 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 3.28E-15 | 11 | 55 | No hit | No description |
| Pfam | PF00046 | 1.0E-13 | 11 | 55 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 7.4E-15 | 11 | 55 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 12.843 | 14 | 57 | IPR001356 | Homeobox domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MDGHRCGARR ILALEAAFKQ CPHPDETQVA NLSRETGMTP QQIKYWFQTR RAQIKASDPG 60 IFIVGSLMLS FDNFGEADGG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| UniProt | Transcription factor which acts as positive regulator of drought stress tolerance. Can transactivate CIPK3, NCED3 and ERECTA (PubMed:18451323). Transactivates several cell-wall-loosening protein genes by directly binding to HD motifs in their promoters. These target genes play important roles in coordinating cell-wall extensibility with root development and growth (PubMed:24821957). Transactivates CYP74A/AOS, AOC3, OPR3 and 4CLL5/OPCL1 genes by directly binding to HD motifs in their promoters. These target genes are involved in jasmonate (JA) biosynthesis, and JA signaling affects root architecture by activating auxin signaling, which promotes lateral root formation (PubMed:25752924). Acts as negative regulator of trichome branching (PubMed:16778018, PubMed:24824485). Required for the establishment of giant cell identity on the abaxial side of sepals (PubMed:23095885). May regulate cell differentiation and proliferation during root and shoot meristem development (PubMed:25564655). {ECO:0000269|PubMed:16778018, ECO:0000269|PubMed:18451323, ECO:0000269|PubMed:23095885, ECO:0000269|PubMed:24821957, ECO:0000269|PubMed:24824485, ECO:0000269|PubMed:25564655, ECO:0000269|PubMed:25752924}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018855077.1 | 2e-17 | PREDICTED: homeobox-leucine zipper protein ROC3-like, partial | ||||
| Swissprot | Q69T58 | 3e-17 | ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8 | ||||
| Swissprot | Q9FX31 | 2e-17 | HDG11_ARATH; Homeobox-leucine zipper protein HDG11 | ||||
| TrEMBL | M8C863 | 6e-54 | M8C863_AEGTA; Homeobox-leucine zipper protein HDG11 | ||||
| STRING | EMT23227 | 1e-54 | (Aegilops tauschii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP25104 | 2 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G73360.1 | 9e-20 | homeodomain GLABROUS 11 | ||||




