| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 100.7 | 5.6e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA+E+SvLCdaev +iifs++gklye+s+
EMT25213 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVGLIIFSTKGKLYEFST 59
79***********************************************96 PP
|
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | GQ451779 | 7e-99 | GQ451779.1 Triticum aestivum isolate 97D7_20_02_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451782 | 7e-99 | GQ451782.1 Triticum aestivum isolate 98B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451783 | 7e-99 | GQ451783.1 Triticum aestivum isolate 98D_1_20_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451785 | 7e-99 | GQ451785.1 Triticum aestivum isolate 99B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451786 | 7e-99 | GQ451786.1 Triticum aestivum isolate 99D_1_20_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451787 | 7e-99 | GQ451787.1 Triticum aestivum isolate 99D_3_20_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451791 | 7e-99 | GQ451791.1 Triticum aestivum isolate 100B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451797 | 7e-99 | GQ451797.1 Triticum aestivum isolate 101B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451802 | 7e-99 | GQ451802.1 Triticum aestivum isolate 102D23_27_02_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451809 | 7e-99 | GQ451809.1 Triticum aestivum isolate 105D8_06_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451811 | 7e-99 | GQ451811.1 Triticum aestivum isolate 106B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451812 | 7e-99 | GQ451812.1 Triticum aestivum isolate 106D3+D6_06_03_09 vernalization protein (Vrn1) gene, Vrn1-D1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451814 | 7e-99 | GQ451814.1 Triticum aestivum isolate 113_7_3_02_09 vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451818 | 7e-99 | GQ451818.1 Triticum turgidum subsp. turanicum isolate 118B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds. |
| GenBank | GQ451820 | 7e-99 | GQ451820.1 Triticum turgidum isolate 119B vernalization protein (Vrn1) gene, Vrn1-B1 allele, promoter region, exon1 and partial cds. |
| GenBank | HQ130482 | 7e-99 | HQ130482.2 Triticum aestivum cultivar Saratovskaya29 Vrn-B1 (Vrn-B1) gene, Vrn-B1-c allele, promoter region and complete cds. |
| GenBank | HQ130483 | 7e-99 | HQ130483.2 Triticum aestivum cultivar Diamant2 Vrn-B1 (Vrn-B1) gene, Vrn-B1-a allele, promoter region and complete cds. |
| GenBank | HQ593668 | 7e-99 | HQ593668.1 Triticum aestivum Vrn-B1c (Vrn-B1c) gene, intron 1 and partial cds. |
| GenBank | JN817430 | 7e-99 | JN817430.1 Triticum carthlicum genotype PI 94749 retrotransposon VRN, complete sequence; and VRN-B1 (VRN-B1) gene, complete cds. |
| GenBank | JN817431 | 7e-99 | JN817431.1 Triticum durum cultivar Lebsock Vrn-B1 (VRN-B1) gene, complete cds. |